Mouse Insulin C- peptide 

To Order Contact us: stephen@expresspharmapulse.com

ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5
EK2663	SAB	96 tests	EUR 663.6
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids.

Insulin Receptor (INSR) Peptide
20-abx266328	Abbexa	EUR 594.00 EUR 978.00 EUR 427.20	10 mg 25 mg 5 mg

Insulin Receptor Blocking Peptide
AF4692-BP	Affbiotech	1mg	EUR 234

Insulin Receptor (INSR) Amide Peptide
20-abx266403	Abbexa	EUR 627.60 EUR 1045.20 EUR 460.80	10 mg 25 mg 5 mg

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-192T	BlueGene	192 tests	EUR 1524
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E03R0119-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep
EF012910	Lifescience Market	96 Tests	EUR 826.8

Insulin Receptor (INSR) Blocking Peptide
20-abx062798	Abbexa	EUR 326.40 EUR 493.20	1 mg 5 mg

Insulin Receptor (INSR) Blocking Peptide
20-abx161901	Abbexa	EUR 326.40 EUR 493.20	1 mg 5 mg

Insulin Receptor beta Blocking Peptide
DF6088-BP	Affbiotech	1mg	EUR 234

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]
INSB25-P	Alpha Diagnostics	500 ug	EUR 416.4

Goat Anti-Human/mouse/rat Insulin chain A peptide IgG, aff pure
INSA21-A	Alpha Diagnostics	100 ul	EUR 578.4

Insulin Receptor (1142-1153) (Biotin) Peptide
20-abx266416	Abbexa	EUR 627.60 EUR 1045.20 EUR 460.80	10 mg 25 mg 5 mg

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit
abx254542-96tests	Abbexa	96 tests	EUR 848.4

Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit
abx390435-96tests	Abbexa	96 tests	EUR 1093.2

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit
EM0166	FN Test	96T	EUR 628.92
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml

Monoclonal Anti-Human/mouse/rat Insulin chain B peptide IgG, aff pure
INSB22-M	Alpha Diagnostics	100 ul	EUR 578.4

Insulin Like Growth Factor 1 (IGF1) Peptide
20-abx266444	Abbexa	EUR 661.20 EUR 1111.20 EUR 477.60	10 mg 25 mg 5 mg

ELISA kit for Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1)
E-EL-M1010	Elabscience Biotech	1 plate of 96 wells	EUR 640.8
Description: A sandwich ELISA kit for quantitative measurement of Mouse RXFP1 (Relaxin/Insulin Like Family Peptide Receptor 1) in samples from Serum, Plasma, Cell supernatant

Insulin Receptor (1142-1153), amide (Biotin) Peptide
20-abx266464	Abbexa	EUR 661.20 EUR 1111.20 EUR 477.60	10 mg 25 mg 5 mg

Kinase Domain of Insulin Receptor (1) Peptide
20-abx266352	Abbexa	EUR 610.80 EUR 1028.40 EUR 444.00	10 mg 25 mg 5 mg

Kinase Domain of Insulin Receptor (2) Peptide
20-abx266448	Abbexa	EUR 661.20 EUR 1111.20 EUR 477.60	10 mg 25 mg 5 mg

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide
20-abx068858	Abbexa	EUR 844.80 EUR 343.20 EUR 2614.80 EUR 1011.60 EUR 610.80	100 ug 10 ug 1 mg 200 ug 50 ug

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide
20-abx068859	Abbexa	EUR 878.40 EUR 343.20 EUR 2766.00 EUR 1062.00 EUR 627.60	100 ug 10 ug 1 mg 200 ug 50 ug

Human Insulin- like peptide INSL6, INSL6 ELISA KIT
ELI-12379h	Lifescience Market	96 Tests	EUR 988.8

Human Insulin- like peptide INSL5, INSL5 ELISA KIT
ELI-20454h	Lifescience Market	96 Tests	EUR 988.8

Insulin Like Growth Factor 1 (IGF1) (30-41) Peptide
20-abx266288	Abbexa	EUR 594.00 EUR 978.00 EUR 427.20	10 mg 25 mg 5 mg

Bovine Insulin- like peptide INSL6, INSL6 ELISA KIT
ELI-42113b	Lifescience Market	96 Tests	EUR 1113.6

Human Insulin-like peptide INSL5 (INSL5) ELISA Kit
abx570706-96tests	Abbexa	96 tests	EUR 801.6

Human Insulin-like peptide INSL5(INSL5) ELISA kit
CSB-EL011749HU-24T	Cusabio	1 plate of 24 wells	EUR 198
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Insulin-like peptide INSL5(INSL5) ELISA kit
1-CSB-EL011749HU	Cusabio	EUR 964.80 EUR 6118.80 EUR 3244.80	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

IGF-I Receptor/Insulin Receptor Blocking Peptide
AF4697-BP	Affbiotech	1mg	EUR 234

Insulin Like Growth Factor 1 (IGF1) (1-3) Peptide
20-abx265710	Abbexa	EUR 393.60 EUR 594.00 EUR 326.40	10 mg 25 mg 5 mg

Insulin Like Growth Factor 1 (IGF1) Analog Peptide
20-abx266295	Abbexa	EUR 594.00 EUR 978.00 EUR 427.20	10 mg 25 mg 5 mg

Mouse/rat/hamster/Insulin A chain peptide (90-110 aa; Cys-95-Cys100) [GIVDQCCTSICSLYQLENYCN]
INSA15-P	Alpha Diagnostics	500 ug	EUR 343.2

Kinase Domain of Insulin Receptor (2) (Biotin) Peptide
20-abx266404	Abbexa	EUR 627.60 EUR 1045.20 EUR 460.80	10 mg 25 mg 5 mg

Insulin Like Growth Factor 1 (IGF1) Blocking Peptide
20-abx161136	Abbexa	EUR 326.40 EUR 493.20	1 mg 5 mg

Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide
20-abx161651	Abbexa	EUR 376.80 EUR 610.80	1 mg 5 mg

Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide
20-abx161652	Abbexa	EUR 376.80 EUR 610.80	1 mg 5 mg

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)
KTE62243-48T	Abbkine	48T	EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)
KTE62243-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Insulin-like peptide INSL6 (INSL6)
KTE62243-96T	Abbkine	96T	EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)
KTE10416-48T	Abbkine	48T	EUR 424.8
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)
KTE10416-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Bovine Insulin-like peptide INSL6 (INSL6)
KTE10416-96T	Abbkine	96T	EUR 686.4
Description: Quantitative sandwich ELISA for measuring Bovine Insulin-like peptide INSL6 (INSL6) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Early placenta insulin- like peptide, INSL4 ELISA KIT
ELI-03359h	Lifescience Market	96 Tests	EUR 988.8

Human Early placenta insulin-like peptide(INSL4) ELISA kit
CSB-EL011748HU-24T	Cusabio	1 plate of 24 wells	EUR 198
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide (INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Early placenta insulin-like peptide(INSL4) ELISA kit
1-CSB-EL011748HU	Cusabio	EUR 964.80 EUR 6118.80 EUR 3244.80	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Early placenta insulin-like peptide(INSL4) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human INSL4/ Early placenta insulin-like peptide ELISA Kit
E1323Hu	Sunlong	1 Kit	EUR 685.2

Human INSL4(Early placenta insulin-like peptide) ELISA Kit
EH1173	FN Test	96T	EUR 681.12
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide
20-abx062773	Abbexa	EUR 326.40 EUR 493.20	1 mg 5 mg

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide
20-abx062774	Abbexa	EUR 326.40 EUR 493.20	1 mg 5 mg

Insulin Like Growth Factor 1 Receptor (IGF1R) Blocking Peptide
20-abx161890	Abbexa	EUR 326.40 EUR 493.20	1 mg 5 mg

Rat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E02R0119-192T	BlueGene	192 tests	EUR 1524
Description: A sandwich ELISA for quantitative measurement of Rat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E02R0119-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A sandwich ELISA for quantitative measurement of Rat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E02R0119-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A sandwich ELISA for quantitative measurement of Rat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E08R0119-192T	BlueGene	192 tests	EUR 1524
Description: A sandwich ELISA for quantitative measurement of Canine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E08R0119-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A sandwich ELISA for quantitative measurement of Canine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E08R0119-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A sandwich ELISA for quantitative measurement of Canine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E07R0119-192T	BlueGene	192 tests	EUR 1524
Description: A sandwich ELISA for quantitative measurement of Porcine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E07R0119-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A sandwich ELISA for quantitative measurement of Porcine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E07R0119-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A sandwich ELISA for quantitative measurement of Porcine Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
20-abx218407	Abbexa	EUR 510.00 EUR 410.40	100 ug 50 ug

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
20-abx104448	Abbexa	EUR 493.20 EUR 159.60 EUR 1378.80 EUR 678.00 EUR 376.80	100 ug 10 ug 1 mg 200 ug 50 ug

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
20-abx104449	Abbexa	EUR 493.20 EUR 159.60 EUR 1378.80 EUR 678.00 EUR 376.80	100 ug 10 ug 1 mg 200 ug 50 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx174369	Abbexa	EUR 1028.40 EUR 526.80	1 mg 200 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx178245	Abbexa	EUR 1446.00 EUR 693.60	1 mg 200 ug

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx212781	Abbexa	EUR 493.20 EUR 360.00	100 ul 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx211855	Abbexa	EUR 493.20 EUR 360.00	100 ul 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx119157	Abbexa	EUR 376.80 EUR 117.60 EUR 477.60 EUR 594.00	100 ug 10 ug 200 ug 300 µg

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx321215	Abbexa	EUR 526.80 EUR 393.60	100 ul 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx322026	Abbexa	EUR 526.80 EUR 393.60	100 ul 50 ul

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx327281	Abbexa	EUR 376.80 EUR 292.80	100 ug 50 ug

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
abx030698-400ul	Abbexa	400 ul	EUR 627.6

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
abx030698-80l	Abbexa	80 µl	EUR 343.2

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
abx030791-400ul	Abbexa	400 ul	EUR 627.6

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
abx030791-80l	Abbexa	80 µl	EUR 343.2

Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Antibody
20-abx126504	Abbexa	EUR 493.20 EUR 710.40 EUR 218.40 EUR 376.80	100 ul 200 ul 20 ul 50 ul

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody
abx122948-100ug	Abbexa	100 ug	EUR 469.2

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
20-abx328076	Abbexa	EUR 376.80 EUR 292.80	100 ug 50 ug

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody
20-abx338522	Abbexa	EUR 493.20 EUR 2214.00 EUR 718.80 EUR 218.40 EUR 360.00	100 ug 1 mg 200 ug 20 ug 50 ug

Goat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E06R0119-192T	BlueGene	192 tests	EUR 1524
Description: A sandwich ELISA for quantitative measurement of Goat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E06R0119-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A sandwich ELISA for quantitative measurement of Goat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E06R0119-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A sandwich ELISA for quantitative measurement of Goat Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-10ug	Novoprotein	10ug	EUR 242.4
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-1mg	Novoprotein	1mg	EUR 2739.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-500ug	Novoprotein	500ug	EUR 1935.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
C988-50ug	Novoprotein	50ug	EUR 595.2
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Human Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E01R0119-192T	BlueGene	192 tests	EUR 1524
Description: A sandwich ELISA for quantitative measurement of Human Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E01R0119-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A sandwich ELISA for quantitative measurement of Human Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E01R0119-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A sandwich ELISA for quantitative measurement of Human Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

RXFP1 ELISA Kit| Rat Relaxin/Insulin Like Family Peptide Recepto
EF018019	Lifescience Market	96 Tests	EUR 826.8

Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E04R0119-192T	BlueGene	192 tests	EUR 1524
Description: A sandwich ELISA for quantitative measurement of Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E04R0119-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A sandwich ELISA for quantitative measurement of Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E04R0119-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A sandwich ELISA for quantitative measurement of Rabbit Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E09R0119-192T	BlueGene	192 tests	EUR 1524
Description: A sandwich ELISA for quantitative measurement of Monkey Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E09R0119-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A sandwich ELISA for quantitative measurement of Monkey Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit
E09R0119-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A sandwich ELISA for quantitative measurement of Monkey Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Recombinant Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1)
4-RPB456Hu01	Cloud-Clone	EUR 636.10 EUR 294.00 EUR 2055.36 EUR 765.12 EUR 1410.24 EUR 501.60 EUR 4958.40	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Relaxin/Insulin Like Family Peptide Receptor 1 expressed in: E.coli

Recombinant Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1)
4-RPB456Hu02	Cloud-Clone	EUR 605.99 EUR 285.60 EUR 1942.46 EUR 727.49 EUR 1334.98 EUR 481.20 EUR 4676.16	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Description: Recombinant Human Relaxin/Insulin Like Family Peptide Receptor 1 expressed in: E.coli

RR-SRC, Insulin Receptor Tyrosine Kinase Substrate (Biotin) Peptide
20-abx265690	Abbexa	EUR 661.20 EUR 1111.20 EUR 477.60	10 mg 25 mg 5 mg

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody (HRP)
20-abx337465	Abbexa	EUR 493.20 EUR 2214.00 EUR 718.80 EUR 218.40 EUR 360.00	100 ug 1 mg 200 ug 20 ug 50 ug

Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Antibody (FITC)
20-abx271099	Abbexa	EUR 560.40 EUR 292.80 EUR 1629.60 EUR 777.60 EUR 427.20	100 ug 10 ug 1 mg 200 ug 50 ug

Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) Antibody (FITC)
20-abx337466	Abbexa	EUR 493.20 EUR 2214.00 EUR 718.80 EUR 218.40 EUR 360.00	100 ug 1 mg 200 ug 20 ug 50 ug

Human Relaxin/Insulin Like Family Peptide Receptor 3 (RXFP3) Protein
20-abx654937	Abbexa	EUR 693.60 EUR 309.60 EUR 2064.00 EUR 828.00 EUR 510.00	100 ug 10 ug 1 mg 200 ug 50 ug

Rat IRAP (Insulin regulated aminopeptidase) Control/blocking peptide #1
IRAP11-P	Alpha Diagnostics	100 ug	EUR 196.8

Rat Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit
abx255980-96tests	Abbexa	96 tests	EUR 848.4

Pig Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit
abx361606-96tests	Abbexa	96 tests	EUR 990

Rat RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit
ER1314	FN Test	96T	EUR 628.92
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 9.375pg/ml

Insulin Like Growth Factor 1 Receptor (IGF1R) (pY1161) Blocking Peptide
20-abx161646	Abbexa	EUR 376.80 EUR 610.80	1 mg 5 mg

Mouse Insulin C- peptide