Mouse Insulin C- peptide
To Order Contact us: stephen@expresspharmapulse.com
Canine C-Peptide ELISA Kit |
RDR-C-Peptide-c-96Tests |
Reddot Biotech |
96 Tests |
EUR 774 |
Mouse C-Peptide ELISA Kit |
DLR-C-Peptide-Mu-48T |
DL Develop |
48T |
EUR 450 |
- Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse C-Peptide ELISA Kit |
DLR-C-Peptide-Mu-96T |
DL Develop |
96T |
EUR 582 |
- Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse C-Peptide ELISA Kit |
RD-C-Peptide-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 446 |
Mouse C-Peptide ELISA Kit |
RD-C-Peptide-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 615 |
Mouse C-Peptide ELISA Kit |
RDR-C-Peptide-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 465 |
Mouse C-Peptide ELISA Kit |
RDR-C-Peptide-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 643 |
Human C-Peptide ELISA Kit |
DLR-C-Peptide-Hu-48T |
DL Develop |
48T |
EUR 398 |
- Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human C-Peptide ELISA Kit |
DLR-C-Peptide-Hu-96T |
DL Develop |
96T |
EUR 511 |
- Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat C-Peptide ELISA Kit |
DLR-C-Peptide-Ra-48T |
DL Develop |
48T |
EUR 467 |
- Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat C-Peptide ELISA Kit |
DLR-C-Peptide-Ra-96T |
DL Develop |
96T |
EUR 605 |
- Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human C-Peptide ELISA Kit |
RD-C-Peptide-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 387 |
Human C-Peptide ELISA Kit |
RD-C-Peptide-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 532 |
Rat C-Peptide ELISA Kit |
RD-C-Peptide-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 465 |
Rat C-Peptide ELISA Kit |
RD-C-Peptide-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 643 |
Human C-Peptide ELISA Kit |
RDR-C-Peptide-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 404 |
Human C-Peptide ELISA Kit |
RDR-C-Peptide-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 556 |
Rat C-Peptide ELISA Kit |
RDR-C-Peptide-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 486 |
Rat C-Peptide ELISA Kit |
RDR-C-Peptide-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 672 |
Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ] |
INSC35-P |
Alpha Diagnostics |
500 ug |
EUR 347 |
Insulin Blocking Peptide |
AF5109-BP |
Affbiotech |
1mg |
EUR 195 |
Insulin Blocking Peptide |
20-abx064168 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Insulin Blocking Peptide |
20-abx064169 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Insulin Peptide (OVA) |
20-abx165763 |
Abbexa |
-
EUR 523.00
-
EUR 244.00
-
EUR 1497.00
-
EUR 606.00
-
EUR 384.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Insulin Receptor Blocking Peptide |
AF4692-BP |
Affbiotech |
1mg |
EUR 195 |
Human Insulin B Peptide |
abx670051-5mg |
Abbexa |
5 mg |
EUR 356 |
|
Insulin Receptor (INSR) Peptide |
20-abx266328 |
Abbexa |
-
EUR 495.00
-
EUR 815.00
-
EUR 356.00
|
|
- Shipped within 5-10 working days.
|
Control/Blocking peptide for Mouse Vimentin (Vim) |
VIM11-C |
Alpha Diagnostics |
100 ug |
EUR 164 |
Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein |
IGFBP53-C |
Alpha Diagnostics |
100 ul |
EUR 286 |
ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5 |
EK2663 |
SAB |
96 tests |
EUR 553 |
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids. |
Insulin Receptor (INSR) Blocking Peptide |
20-abx161901 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Insulin Receptor (INSR) Blocking Peptide |
20-abx062798 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Insulin Receptor (INSR) Amide Peptide |
20-abx266403 |
Abbexa |
-
EUR 523.00
-
EUR 871.00
-
EUR 384.00
|
|
- Shipped within 5-10 working days.
|
Insulin Receptor beta Blocking Peptide |
DF6088-BP |
Affbiotech |
1mg |
EUR 195 |
Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit |
abx574867-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 1-3 weeks.
|
Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT |
ELI-13429m |
Lifescience Market |
96 Tests |
EUR 865 |
Mouse Insulin- like peptide INSL5, Insl5 ELISA KIT |
ELI-43454m |
Lifescience Market |
96 Tests |
EUR 865 |
Mouse Insulin-like peptide INSL5(INSL5) ELISA kit |
CSB-EL011749MO-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Mouse Insulin-like peptide INSL5(INSL5) ELISA kit |
1-CSB-EL011749MO |
Cusabio |
-
EUR 804.00
-
EUR 5099.00
-
EUR 2704.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Control/Blocking peptide for Mouse TATA box-binding protein |
TATAB11-C |
Alpha Diagnostics |
100 ug |
EUR 164 |
Monoclonal Anti-Human Insulin C-peptide IgG, aff pure |
INSC23-M |
Alpha Diagnostics |
100 ul |
EUR 482 |
Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control |
IGFBP33-C |
Alpha Diagnostics |
100 ul |
EUR 286 |
Control/Blocking peptide for Mouse Neuronal migration protein doublecortin (DCX) |
DCX11-C |
Alpha Diagnostics |
100 ug |
EUR 164 |
Control/Blocking peptide for Mouse Neurogenic differentation factor 1 (NeuroD1) |
NEUD1-C |
Alpha Diagnostics |
100 ug |
EUR 164 |
Mouse C-Peptide/ C-Peptide ELISA Kit |
E0316Mo |
Sunlong |
1 Kit |
EUR 571 |
Mouse C-Peptide(C-Peptide) ELISA Kit |
EM0947 |
FN Test |
96T |
EUR 476.25 |
- Detection range: 0.156-10 ng/ml
- Alias: C-P(C-Peptide)/Connecting Peptide
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 0.094 ng/ml |
Phospho-Insulin Receptor (Tyr1355) Blocking Peptide |
AF4392-BP |
Affbiotech |
1mg |
EUR 195 |
Insulin Receptor (1142-1153) (Biotin) Peptide |
20-abx266416 |
Abbexa |
-
EUR 523.00
-
EUR 871.00
-
EUR 384.00
|
|
- Shipped within 5-10 working days.
|
Canine Insulin (INS) ELISA Kit |
DLR-INS-c-48T |
DL Develop |
48T |
EUR 624 |
- Should the Canine Insulin (INS) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine Insulin (INS) ELISA Kit |
DLR-INS-c-96T |
DL Develop |
96T |
EUR 821 |
- Should the Canine Insulin (INS) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine Insulin (INS) ELISA Kit |
RDR-INS-c-48Tests |
Reddot Biotech |
48 Tests |
EUR 672 |
Canine Insulin (INS) ELISA Kit |
RDR-INS-c-96Tests |
Reddot Biotech |
96 Tests |
EUR 938 |
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB |
IGFBP13-C |
Alpha Diagnostics |
100 ul |
EUR 286 |
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB |
IGFBP23-C |
Alpha Diagnostics |
100 ul |
EUR 286 |
Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB |
IGFBP63-C |
Alpha Diagnostics |
100 ul |
EUR 286 |
Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB |
IGFBP73-C |
Alpha Diagnostics |
100 ul |
EUR 286 |
Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide |
20-abx068858 |
Abbexa |
-
EUR 704.00
-
EUR 286.00
-
EUR 2179.00
-
EUR 843.00
-
EUR 509.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-12 working days.
|
Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide |
20-abx068859 |
Abbexa |
-
EUR 732.00
-
EUR 286.00
-
EUR 2305.00
-
EUR 885.00
-
EUR 523.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-12 working days.
|
IGF-I Receptor/Insulin Receptor Blocking Peptide |
AF4697-BP |
Affbiotech |
1mg |
EUR 195 |
Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide |
20-abx161651 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide |
20-abx161652 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Kinase Domain of Insulin Receptor (1) Peptide |
20-abx266352 |
Abbexa |
-
EUR 509.00
-
EUR 857.00
-
EUR 370.00
|
|
- Shipped within 5-10 working days.
|
Insulin Like Growth Factor 1 (IGF1) Peptide |
20-abx266444 |
Abbexa |
-
EUR 551.00
-
EUR 926.00
-
EUR 398.00
|
|
- Shipped within 5-10 working days.
|
Kinase Domain of Insulin Receptor (2) Peptide |
20-abx266448 |
Abbexa |
-
EUR 551.00
-
EUR 926.00
-
EUR 398.00
|
|
- Shipped within 5-10 working days.
|
Insulin Receptor (1142-1153), amide (Biotin) Peptide |
20-abx266464 |
Abbexa |
-
EUR 551.00
-
EUR 926.00
-
EUR 398.00
|
|
- Shipped within 5-10 working days.
|
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit |
E03R0119-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit |
E03R0119-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit |
E03R0119-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep |
EF012910 |
Lifescience Market |
96 Tests |
EUR 689 |
Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] |
INSB25-P |
Alpha Diagnostics |
500 ug |
EUR 347 |
Insulin C-terminal Antibody |
abx021216-1mg |
Abbexa |
1 mg |
EUR 787 |
- Shipped within 5-10 working days.
|
Rabbit anti-Lamin B1 Control/Blocking Peptide |
BL11-C |
Alpha Diagnostics |
100 ug |
EUR 164 |
Beta catenin 1 (CTNNB1) Control/Blocking Peptide |
BCTN11-C |
Alpha Diagnostics |
100 ug |
EUR 164 |
Control/Blocking peptide for Ephrin-B2 antibody |
NIVE2B-C |
Alpha Diagnostics |
100 ug |
EUR 164 |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-10ug |
Novoprotein |
10ug |
EUR 202 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-1mg |
Novoprotein |
1mg |
EUR 2283 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-500ug |
Novoprotein |
500ug |
EUR 1613 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-50ug |
Novoprotein |
50ug |
EUR 496 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Custom Peptide Synthesis (crude and desalted; mg-kg size, price based upon peptide size: 2-100 aa) |
PEP-C |
Alpha Diagnostics |
1 |
Ask for price |
Mouse Connecting Peptide (C-Peptide) ELISA Kit |
abx576327-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 5-12 working days.
|
Mouse C-Type Natriuretic Peptide (NPPC) Peptide |
20-abx066174 |
Abbexa |
-
EUR 676.00
-
EUR 286.00
-
EUR 2082.00
-
EUR 801.00
-
EUR 481.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Mouse C-Type Natriuretic Peptide (NPPC) Peptide |
20-abx066178 |
Abbexa |
-
EUR 676.00
-
EUR 286.00
-
EUR 2082.00
-
EUR 801.00
-
EUR 481.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Mouse Connecting Peptide (C-Peptide) ELISA Kit |
20-abx156702 |
Abbexa |
-
EUR 6642.00
-
EUR 3542.00
-
EUR 825.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Mouse Connecting Peptide (C-Peptide) ELISA Kit |
abx051521-96tests |
Abbexa |
96 tests |
EUR 754 |
- Shipped within 5-10 working days.
|
Mouse Connecting Peptide (C-Peptide) ELISA Kit |
abx255287-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 5-12 working days.
|
Mouse C- Peptide, connecting peptide ELISA Kit |
CELI-66099m |
Lifescience Market |
96 Tests |
EUR 865 |
C-Peptide ELISA Kit| Mouse C-Peptide ELISA Kit |
EF013534 |
Lifescience Market |
96 Tests |
EUR 689 |
Control/Blocking peptide for Mouse Microtubule-associated proteins 1A/1B light chain 3B (anti-Map1lc3b) |
MAP13B-C |
Alpha Diagnostics |
100 ug |
EUR 164 |
Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control |
IGFBP31-C |
Alpha Diagnostics |
100 ul |
EUR 286 |
Control/Blocking peptide Glutamate receptor ionotropic (NMDA/GRN1) |
NMDA11-C |
Alpha Diagnostics |
100 ug |
EUR 164 |
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate) |
RA0164-C.1 |
ScyTek Laboratories |
0.1 ml |
EUR 125 |
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate) |
RA0164-C.5 |
ScyTek Laboratories |
0.5 ml |
EUR 300 |
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate) |
RA0165-C.1 |
ScyTek Laboratories |
0.1 ml |
EUR 125 |
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate) |
RA0165-C.5 |
ScyTek Laboratories |
0.5 ml |
EUR 300 |
Purified human recomb insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control |
IGFBP51-C |
Alpha Diagnostics |
100 ul |
EUR 286 |
Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit |
EM0166 |
FN Test |
96T |
EUR 524.1 |
- Detection range: 15.625-1000 pg/ml
- Uniprot ID: Q6R6I7
- Alias: RXFP1/Relaxin/Insulin Like Family Peptide Receptor 1)
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml |
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit |
abx254542-96tests |
Abbexa |
96 tests |
EUR 707 |
- Shipped within 5-12 working days.
|
Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit |
abx390435-96tests |
Abbexa |
96 tests |
EUR 911 |
- Shipped within 5-12 working days.
|
Human Insulin-like peptide INSL5 (INSL5) ELISA Kit |
abx570706-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 1-3 weeks.
|
Human Insulin- like peptide INSL6, INSL6 ELISA KIT |
ELI-12379h |
Lifescience Market |
96 Tests |
EUR 824 |
Human Insulin- like peptide INSL5, INSL5 ELISA KIT |
ELI-20454h |
Lifescience Market |
96 Tests |
EUR 824 |
Bovine Insulin- like peptide INSL6, INSL6 ELISA KIT |
ELI-42113b |
Lifescience Market |
96 Tests |
EUR 928 |
Insulin Like Growth Factor 1 (IGF1) Blocking Peptide |
20-abx161136 |
Abbexa |
|
|
- Shipped within 5-10 working days.
|
Insulin Like Growth Factor 1 (IGF1) Analog Peptide |
20-abx266295 |
Abbexa |
-
EUR 495.00
-
EUR 815.00
-
EUR 356.00
|
|
- Shipped within 5-10 working days.
|
Kinase Domain of Insulin Receptor (2) (Biotin) Peptide |
20-abx266404 |
Abbexa |
-
EUR 523.00
-
EUR 871.00
-
EUR 384.00
|
|
- Shipped within 5-10 working days.
|
Human Insulin-like peptide INSL5(INSL5) ELISA kit |
CSB-EL011749HU-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Mouse Insulin C- peptide