Mouse Insulin C- peptide 

To Order Contact us: stephen@expresspharmapulse.com

Saccharomyces cerevisiae Trehalose-phosphatase (TPS2)

1-CSB-RP165694Ye(c)
  • EUR 733.20
  • EUR 370.80
  • EUR 2192.40
  • EUR 1126.80
  • EUR 1461.60
  • EUR 476.40
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Saccharomyces cerevisiae Trehalose-phosphatase(TPS2),partial expressed in E.coli

Human Histone deacetylase 7 (HDAC7)

1-CSB-RP178994h(C)
  • EUR 456.00
  • EUR 256.80
  • EUR 1570.80
  • EUR 672.00
  • EUR 1047.60
  • EUR 314.40
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Human Histone deacetylase 7(HDAC7),partial expressed in E.coli

Human Telomerase protein component 1 (TEP1)

1-CSB-RP180494h(c)
  • EUR 456.00
  • EUR 256.80
  • EUR 1570.80
  • EUR 672.00
  • EUR 1047.60
  • EUR 314.40
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Human Telomerase protein component 1(TEP1),partial expressed in E.coli

Human Collagen alpha-1 (XVII) chain (COL17A1)

1-CSB-RP180994h(c)
  • EUR 456.00
  • EUR 256.80
  • EUR 1570.80
  • EUR 672.00
  • EUR 1047.60
  • EUR 314.40
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Human Collagen alpha-1(XVII) chain(COL17A1),partial expressed in E.coli

Saccharomyces cerevisiae Neutral trehalase (NTH1)

1-CSB-RP181594Ye(c)
  • EUR 733.20
  • EUR 370.80
  • EUR 2192.40
  • EUR 1126.80
  • EUR 1461.60
  • EUR 476.40
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Saccharomyces cerevisiae Neutral trehalase(NTH1),partial expressed in E.coli

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-48T 48T
EUR 540
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-96T 96T
EUR 698.4
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-48Tests 48 Tests
EUR 535.2

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-96Tests 96 Tests
EUR 738

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-48Tests 48 Tests
EUR 558

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-96Tests 96 Tests
EUR 771.6

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-48T 48T
EUR 632.4
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-96T 96T
EUR 825.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-48Tests 48 Tests
EUR 639.6

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-96Tests 96 Tests
EUR 888

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-48Tests 48 Tests
EUR 668.4

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-96Tests 96 Tests
EUR 928.8

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-48T 48T
EUR 477.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-96T 96T
EUR 613.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-48T 48T
EUR 560.4
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-96T 96T
EUR 726
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-48Tests 48 Tests
EUR 464.4

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-96Tests 96 Tests
EUR 638.4

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-48Tests 48 Tests
EUR 558

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-96Tests 96 Tests
EUR 771.6

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-48Tests 48 Tests
EUR 484.8

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-96Tests 96 Tests
EUR 667.2

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-48Tests 48 Tests
EUR 583.2

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-96Tests 96 Tests
EUR 806.4

Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ]

INSC35-P 500 ug
EUR 416.4

Insulin Peptide (OVA)

20-abx165763
  • EUR 627.60
  • EUR 292.80
  • EUR 1796.40
  • EUR 727.20
  • EUR 460.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Insulin Blocking Peptide

20-abx064168
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Blocking Peptide

20-abx064169
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Blocking Peptide

AF5109-BP 1mg
EUR 234

Insulin; Clone 2D11-H5 (Concentrate)

A00114-C 1 ml
EUR 524.4

Insulin Receptor (INSR) Peptide

20-abx266328
  • EUR 594.00
  • EUR 978.00
  • EUR 427.20
  • 10 mg
  • 25 mg
  • 5 mg

Human Insulin B Peptide

abx670051-5mg 5 mg
EUR 427.2

Insulin Receptor Blocking Peptide

AF4692-BP 1mg
EUR 234

Control/Blocking peptide Mouse BCL-2

BCL21-C 100 ug
EUR 196.8

Control/Blocking peptide for Mouse Vimentin (Vim)

VIM11-C 100 ug
EUR 196.8

Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein

IGFBP53-C 100 ul
EUR 343.2

ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5

EK2663 96 tests
EUR 663.6
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids.

Insulin Receptor (INSR) Blocking Peptide

20-abx161901
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) Blocking Peptide

20-abx062798
  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) Amide Peptide

20-abx266403
  • EUR 627.60
  • EUR 1045.20
  • EUR 460.80
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Receptor beta Blocking Peptide

DF6088-BP 1mg
EUR 234

Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx574867-96tests 96 tests
EUR 801.6

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749MO-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

1-CSB-EL011749MO
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Insulin- like peptide INSL5, Insl5 ELISA KIT

ELI-43454m 96 Tests
EUR 1038

Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT

ELI-13429m 96 Tests
EUR 1038

Control/Blocking peptide for Mouse TATA box-binding protein

TATAB11-C 100 ug
EUR 196.8

Monoclonal Anti-Human Insulin C-peptide IgG, aff pure

INSC23-M 100 ul
EUR 578.4

Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control

IGFBP33-C 100 ul
EUR 343.2

Control/Blocking peptide for Mouse Neuronal migration protein doublecortin (DCX)

DCX11-C 100 ug
EUR 196.8

Control/Blocking peptide for Mouse Neurogenic differentation factor 1 (NeuroD1)

NEUD1-C 100 ug
EUR 196.8

Control/Blocking peptide CD40

CD4011-C 100 ug
EUR 196.8

Control/Blocking peptide EOMES

EMS11-C 100 ug
EUR 196.8

Mouse C-Peptide(C-Peptide) ELISA Kit

EM0947 96T
EUR 571.5
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 0.094 ng/ml

Mouse C-Peptide/ C-Peptide ELISA Kit

E0316Mo 1 Kit
EUR 685.2

Insulin Receptor (1142-1153) (Biotin) Peptide

20-abx266416
  • EUR 627.60
  • EUR 1045.20
  • EUR 460.80
  • 10 mg
  • 25 mg
  • 5 mg

Phospho-Insulin Receptor (Tyr1355) Blocking Peptide

AF4392-BP 1mg
EUR 234

Canine Insulin (INS) ELISA Kit

DLR-INS-c-48T 48T
EUR 748.8
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit

DLR-INS-c-96T 96T
EUR 985.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit

RDR-INS-c-48Tests 48 Tests
EUR 806.4

Canine Insulin (INS) ELISA Kit

RDR-INS-c-96Tests 96 Tests
EUR 1125.6

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB

IGFBP13-C 100 ul
EUR 343.2

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB

IGFBP23-C 100 ul
EUR 343.2

Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB

IGFBP63-C 100 ul
EUR 343.2

Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB

IGFBP73-C 100 ul
EUR 343.2

Control/Blocking peptide Human BCL-2

BCL11-C 100 ug
EUR 196.8

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

20-abx068858
  • EUR 844.80
  • EUR 343.20
  • EUR 2614.80
  • EUR 1011.60
  • EUR 610.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

20-abx068859
  • EUR 878.40
  • EUR 343.20
  • EUR 2766.00
  • EUR 1062.00
  • EUR 627.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep

EF012910 96 Tests
EUR 826.8

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]

INSB25-P 500 ug
EUR 416.4

Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide

20-abx161651
  • EUR 376.80
  • EUR 610.80
  • 1 mg
  • 5 mg

Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide

20-abx161652
  • EUR 376.80
  • EUR 610.80
  • 1 mg
  • 5 mg

Kinase Domain of Insulin Receptor (1) Peptide

20-abx266352
  • EUR 610.80
  • EUR 1028.40
  • EUR 444.00
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Like Growth Factor 1 (IGF1) Peptide

20-abx266444
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Kinase Domain of Insulin Receptor (2) Peptide

20-abx266448
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

Insulin Receptor (1142-1153), amide (Biotin) Peptide

20-abx266464
  • EUR 661.20
  • EUR 1111.20
  • EUR 477.60
  • 10 mg
  • 25 mg
  • 5 mg

IGF-I Receptor/Insulin Receptor Blocking Peptide

AF4697-BP 1mg
EUR 234

Mouse Connecting Peptide (C-Peptide) ELISA Kit

20-abx156702
  • EUR 7970.40
  • EUR 4250.40
  • EUR 990.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx051521-96tests 96 tests
EUR 904.8

Mouse C-Type Natriuretic Peptide (NPPC) Peptide

20-abx066174
  • EUR 811.20
  • EUR 343.20
  • EUR 2498.40
  • EUR 961.20
  • EUR 577.20
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse C-Type Natriuretic Peptide (NPPC) Peptide

20-abx066178
  • EUR 811.20
  • EUR 343.20
  • EUR 2498.40
  • EUR 961.20
  • EUR 577.20
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx255287-96tests 96 tests
EUR 801.6

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx576327-96tests 96 tests
EUR 801.6

Mouse C- Peptide, connecting peptide ELISA Kit

CELI-66099m 96 Tests
EUR 1038

Insulin C-terminal Antibody

abx021216-1mg 1 mg
EUR 944.4

C-Peptide ELISA Kit| Mouse C-Peptide ELISA Kit

EF013534 96 Tests
EUR 826.8

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-10ug 10ug
EUR 242.4
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-1mg 1mg
EUR 2739.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-500ug 500ug
EUR 1935.6
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-50ug 50ug
EUR 595.2
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Beta catenin 1 (CTNNB1) Control/Blocking Peptide

BCTN11-C 100 ug
EUR 196.8

Rabbit anti-Lamin B1 Control/Blocking Peptide

BL11-C 100 ug
EUR 196.8

Control/Blocking peptide for Ephrin-B2 antibody

NIVE2B-C 100 ug
EUR 196.8

Control/Blocking peptide for Mouse Microtubule-associated proteins 1A/1B light chain 3B (anti-Map1lc3b)

MAP13B-C 100 ug
EUR 196.8

Custom Peptide Synthesis (crude and desalted; mg-kg size, price based upon peptide size: 2-100 aa)

PEP-C 1 Ask for price

Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control

IGFBP31-C 100 ul
EUR 343.2

Control/Blocking peptide Glutamate receptor ionotropic (NMDA/GRN1)

NMDA11-C 100 ug
EUR 196.8

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit

abx254542-96tests 96 tests
EUR 848.4

Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit

abx390435-96tests 96 tests
EUR 1093.2

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

EM0166 96T
EUR 628.92
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)

RA0164-C.1 0.1 ml
EUR 150

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)

RA0164-C.5 0.5 ml
EUR 360

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)

RA0165-C.1 0.1 ml
EUR 150

Mouse Insulin C- peptide