Mouse Insulin C- peptide
To Order Contact us: stephen@expresspharmapulse.com
Saccharomyces cerevisiae Trehalose-phosphatase (TPS2) |
1-CSB-RP165694Ye(c) |
Cusabio |
-
EUR 733.20
-
EUR 370.80
-
EUR 2192.40
-
EUR 1126.80
-
EUR 1461.60
-
EUR 476.40
|
- 100ug
- 10ug
- 1MG
- 200ug
- 500ug
- 50ug
|
|
Description: Recombinant Saccharomyces cerevisiae Trehalose-phosphatase(TPS2),partial expressed in E.coli |
Human Histone deacetylase 7 (HDAC7) |
1-CSB-RP178994h(C) |
Cusabio |
-
EUR 456.00
-
EUR 256.80
-
EUR 1570.80
-
EUR 672.00
-
EUR 1047.60
-
EUR 314.40
|
- 100ug
- 10ug
- 1MG
- 200ug
- 500ug
- 50ug
|
|
Description: Recombinant Human Histone deacetylase 7(HDAC7),partial expressed in E.coli |
Human Telomerase protein component 1 (TEP1) |
1-CSB-RP180494h(c) |
Cusabio |
-
EUR 456.00
-
EUR 256.80
-
EUR 1570.80
-
EUR 672.00
-
EUR 1047.60
-
EUR 314.40
|
- 100ug
- 10ug
- 1MG
- 200ug
- 500ug
- 50ug
|
|
Description: Recombinant Human Telomerase protein component 1(TEP1),partial expressed in E.coli |
Human Collagen alpha-1 (XVII) chain (COL17A1) |
1-CSB-RP180994h(c) |
Cusabio |
-
EUR 456.00
-
EUR 256.80
-
EUR 1570.80
-
EUR 672.00
-
EUR 1047.60
-
EUR 314.40
|
- 100ug
- 10ug
- 1MG
- 200ug
- 500ug
- 50ug
|
|
Description: Recombinant Human Collagen alpha-1(XVII) chain(COL17A1),partial expressed in E.coli |
Saccharomyces cerevisiae Neutral trehalase (NTH1) |
1-CSB-RP181594Ye(c) |
Cusabio |
-
EUR 733.20
-
EUR 370.80
-
EUR 2192.40
-
EUR 1126.80
-
EUR 1461.60
-
EUR 476.40
|
- 100ug
- 10ug
- 1MG
- 200ug
- 500ug
- 50ug
|
|
Description: Recombinant Saccharomyces cerevisiae Neutral trehalase(NTH1),partial expressed in E.coli |
Mouse C-Peptide ELISA Kit |
DLR-C-Peptide-Mu-48T |
DL Develop |
48T |
EUR 540 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse C-Peptide ELISA Kit |
DLR-C-Peptide-Mu-96T |
DL Develop |
96T |
EUR 698.4 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse C-Peptide ELISA Kit |
RD-C-Peptide-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 535.2 |
Mouse C-Peptide ELISA Kit |
RD-C-Peptide-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 738 |
Mouse C-Peptide ELISA Kit |
RDR-C-Peptide-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 558 |
Mouse C-Peptide ELISA Kit |
RDR-C-Peptide-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 771.6 |
Canine C-Peptide ELISA Kit |
DLR-C-Peptide-c-48T |
DL Develop |
48T |
EUR 632.4 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine C-Peptide ELISA Kit |
DLR-C-Peptide-c-96T |
DL Develop |
96T |
EUR 825.6 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine C-Peptide ELISA Kit |
RD-C-Peptide-c-48Tests |
Reddot Biotech |
48 Tests |
EUR 639.6 |
Canine C-Peptide ELISA Kit |
RD-C-Peptide-c-96Tests |
Reddot Biotech |
96 Tests |
EUR 888 |
Canine C-Peptide ELISA Kit |
RDR-C-Peptide-c-48Tests |
Reddot Biotech |
48 Tests |
EUR 668.4 |
Canine C-Peptide ELISA Kit |
RDR-C-Peptide-c-96Tests |
Reddot Biotech |
96 Tests |
EUR 928.8 |
Human C-Peptide ELISA Kit |
DLR-C-Peptide-Hu-48T |
DL Develop |
48T |
EUR 477.6 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human C-Peptide ELISA Kit |
DLR-C-Peptide-Hu-96T |
DL Develop |
96T |
EUR 613.2 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat C-Peptide ELISA Kit |
DLR-C-Peptide-Ra-48T |
DL Develop |
48T |
EUR 560.4 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat C-Peptide ELISA Kit |
DLR-C-Peptide-Ra-96T |
DL Develop |
96T |
EUR 726 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human C-Peptide ELISA Kit |
RD-C-Peptide-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 464.4 |
Human C-Peptide ELISA Kit |
RD-C-Peptide-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 638.4 |
Rat C-Peptide ELISA Kit |
RD-C-Peptide-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 558 |
Rat C-Peptide ELISA Kit |
RD-C-Peptide-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 771.6 |
Human C-Peptide ELISA Kit |
RDR-C-Peptide-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 484.8 |
Human C-Peptide ELISA Kit |
RDR-C-Peptide-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 667.2 |
Rat C-Peptide ELISA Kit |
RDR-C-Peptide-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 583.2 |
Rat C-Peptide ELISA Kit |
RDR-C-Peptide-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 806.4 |
Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ] |
INSC35-P |
Alpha Diagnostics |
500 ug |
EUR 416.4 |
Insulin Peptide (OVA) |
20-abx165763 |
Abbexa |
-
EUR 627.60
-
EUR 292.80
-
EUR 1796.40
-
EUR 727.20
-
EUR 460.80
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Insulin Blocking Peptide |
20-abx064168 |
Abbexa |
|
|
|
Insulin Blocking Peptide |
20-abx064169 |
Abbexa |
|
|
|
Insulin Blocking Peptide |
AF5109-BP |
Affbiotech |
1mg |
EUR 234 |
Insulin Receptor (INSR) Peptide |
20-abx266328 |
Abbexa |
-
EUR 594.00
-
EUR 978.00
-
EUR 427.20
|
|
|
Human Insulin B Peptide |
abx670051-5mg |
Abbexa |
5 mg |
EUR 427.2 |
|
Insulin Receptor Blocking Peptide |
AF4692-BP |
Affbiotech |
1mg |
EUR 234 |
Control/Blocking peptide for Mouse Vimentin (Vim) |
VIM11-C |
Alpha Diagnostics |
100 ug |
EUR 196.8 |
Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein |
IGFBP53-C |
Alpha Diagnostics |
100 ul |
EUR 343.2 |
ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5 |
EK2663 |
SAB |
96 tests |
EUR 663.6 |
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids. |
Insulin Receptor (INSR) Blocking Peptide |
20-abx161901 |
Abbexa |
|
|
|
Insulin Receptor (INSR) Blocking Peptide |
20-abx062798 |
Abbexa |
|
|
|
Insulin Receptor (INSR) Amide Peptide |
20-abx266403 |
Abbexa |
-
EUR 627.60
-
EUR 1045.20
-
EUR 460.80
|
|
|
Insulin Receptor beta Blocking Peptide |
DF6088-BP |
Affbiotech |
1mg |
EUR 234 |
Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit |
abx574867-96tests |
Abbexa |
96 tests |
EUR 801.6 |
|
Mouse Insulin-like peptide INSL5(INSL5) ELISA kit |
CSB-EL011749MO-24T |
Cusabio |
1 plate of 24 wells |
EUR 198 |
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Mouse Insulin-like peptide INSL5(INSL5) ELISA kit |
1-CSB-EL011749MO |
Cusabio |
-
EUR 964.80
-
EUR 6118.80
-
EUR 3244.80
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Mouse Insulin- like peptide INSL5, Insl5 ELISA KIT |
ELI-43454m |
Lifescience Market |
96 Tests |
EUR 1038 |
Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT |
ELI-13429m |
Lifescience Market |
96 Tests |
EUR 1038 |
Control/Blocking peptide for Mouse TATA box-binding protein |
TATAB11-C |
Alpha Diagnostics |
100 ug |
EUR 196.8 |
Monoclonal Anti-Human Insulin C-peptide IgG, aff pure |
INSC23-M |
Alpha Diagnostics |
100 ul |
EUR 578.4 |
Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control |
IGFBP33-C |
Alpha Diagnostics |
100 ul |
EUR 343.2 |
Control/Blocking peptide for Mouse Neuronal migration protein doublecortin (DCX) |
DCX11-C |
Alpha Diagnostics |
100 ug |
EUR 196.8 |
Control/Blocking peptide for Mouse Neurogenic differentation factor 1 (NeuroD1) |
NEUD1-C |
Alpha Diagnostics |
100 ug |
EUR 196.8 |
Mouse C-Peptide(C-Peptide) ELISA Kit |
EM0947 |
FN Test |
96T |
EUR 571.5 |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 0.094 ng/ml |
Mouse C-Peptide/ C-Peptide ELISA Kit |
E0316Mo |
Sunlong |
1 Kit |
EUR 685.2 |
Insulin Receptor (1142-1153) (Biotin) Peptide |
20-abx266416 |
Abbexa |
-
EUR 627.60
-
EUR 1045.20
-
EUR 460.80
|
|
|
Phospho-Insulin Receptor (Tyr1355) Blocking Peptide |
AF4392-BP |
Affbiotech |
1mg |
EUR 234 |
Canine Insulin (INS) ELISA Kit |
DLR-INS-c-48T |
DL Develop |
48T |
EUR 748.8 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine Insulin (INS) ELISA Kit |
DLR-INS-c-96T |
DL Develop |
96T |
EUR 985.2 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine Insulin (INS) ELISA Kit |
RDR-INS-c-48Tests |
Reddot Biotech |
48 Tests |
EUR 806.4 |
Canine Insulin (INS) ELISA Kit |
RDR-INS-c-96Tests |
Reddot Biotech |
96 Tests |
EUR 1125.6 |
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB |
IGFBP13-C |
Alpha Diagnostics |
100 ul |
EUR 343.2 |
Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB |
IGFBP23-C |
Alpha Diagnostics |
100 ul |
EUR 343.2 |
Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB |
IGFBP63-C |
Alpha Diagnostics |
100 ul |
EUR 343.2 |
Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB |
IGFBP73-C |
Alpha Diagnostics |
100 ul |
EUR 343.2 |
Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide |
20-abx068858 |
Abbexa |
-
EUR 844.80
-
EUR 343.20
-
EUR 2614.80
-
EUR 1011.60
-
EUR 610.80
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide |
20-abx068859 |
Abbexa |
-
EUR 878.40
-
EUR 343.20
-
EUR 2766.00
-
EUR 1062.00
-
EUR 627.60
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit |
E03R0119-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit |
E03R0119-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit |
E03R0119-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep |
EF012910 |
Lifescience Market |
96 Tests |
EUR 826.8 |
Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS] |
INSB25-P |
Alpha Diagnostics |
500 ug |
EUR 416.4 |
Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide |
20-abx161651 |
Abbexa |
|
|
|
Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide |
20-abx161652 |
Abbexa |
|
|
|
Kinase Domain of Insulin Receptor (1) Peptide |
20-abx266352 |
Abbexa |
-
EUR 610.80
-
EUR 1028.40
-
EUR 444.00
|
|
|
Insulin Like Growth Factor 1 (IGF1) Peptide |
20-abx266444 |
Abbexa |
-
EUR 661.20
-
EUR 1111.20
-
EUR 477.60
|
|
|
Kinase Domain of Insulin Receptor (2) Peptide |
20-abx266448 |
Abbexa |
-
EUR 661.20
-
EUR 1111.20
-
EUR 477.60
|
|
|
Insulin Receptor (1142-1153), amide (Biotin) Peptide |
20-abx266464 |
Abbexa |
-
EUR 661.20
-
EUR 1111.20
-
EUR 477.60
|
|
|
IGF-I Receptor/Insulin Receptor Blocking Peptide |
AF4697-BP |
Affbiotech |
1mg |
EUR 234 |
Mouse Connecting Peptide (C-Peptide) ELISA Kit |
20-abx156702 |
Abbexa |
-
EUR 7970.40
-
EUR 4250.40
-
EUR 990.00
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Mouse Connecting Peptide (C-Peptide) ELISA Kit |
abx051521-96tests |
Abbexa |
96 tests |
EUR 904.8 |
|
Mouse C-Type Natriuretic Peptide (NPPC) Peptide |
20-abx066174 |
Abbexa |
-
EUR 811.20
-
EUR 343.20
-
EUR 2498.40
-
EUR 961.20
-
EUR 577.20
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Mouse C-Type Natriuretic Peptide (NPPC) Peptide |
20-abx066178 |
Abbexa |
-
EUR 811.20
-
EUR 343.20
-
EUR 2498.40
-
EUR 961.20
-
EUR 577.20
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Mouse Connecting Peptide (C-Peptide) ELISA Kit |
abx255287-96tests |
Abbexa |
96 tests |
EUR 801.6 |
|
Mouse Connecting Peptide (C-Peptide) ELISA Kit |
abx576327-96tests |
Abbexa |
96 tests |
EUR 801.6 |
|
Mouse C- Peptide, connecting peptide ELISA Kit |
CELI-66099m |
Lifescience Market |
96 Tests |
EUR 1038 |
Insulin C-terminal Antibody |
abx021216-1mg |
Abbexa |
1 mg |
EUR 944.4 |
|
C-Peptide ELISA Kit| Mouse C-Peptide ELISA Kit |
EF013534 |
Lifescience Market |
96 Tests |
EUR 826.8 |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-10ug |
Novoprotein |
10ug |
EUR 242.4 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-1mg |
Novoprotein |
1mg |
EUR 2739.6 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-500ug |
Novoprotein |
500ug |
EUR 1935.6 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His) |
C988-50ug |
Novoprotein |
50ug |
EUR 595.2 |
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
Beta catenin 1 (CTNNB1) Control/Blocking Peptide |
BCTN11-C |
Alpha Diagnostics |
100 ug |
EUR 196.8 |
Rabbit anti-Lamin B1 Control/Blocking Peptide |
BL11-C |
Alpha Diagnostics |
100 ug |
EUR 196.8 |
Control/Blocking peptide for Ephrin-B2 antibody |
NIVE2B-C |
Alpha Diagnostics |
100 ug |
EUR 196.8 |
Control/Blocking peptide for Mouse Microtubule-associated proteins 1A/1B light chain 3B (anti-Map1lc3b) |
MAP13B-C |
Alpha Diagnostics |
100 ug |
EUR 196.8 |
Custom Peptide Synthesis (crude and desalted; mg-kg size, price based upon peptide size: 2-100 aa) |
PEP-C |
Alpha Diagnostics |
1 |
Ask for price |
Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control |
IGFBP31-C |
Alpha Diagnostics |
100 ul |
EUR 343.2 |
Control/Blocking peptide Glutamate receptor ionotropic (NMDA/GRN1) |
NMDA11-C |
Alpha Diagnostics |
100 ug |
EUR 196.8 |
Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit |
abx254542-96tests |
Abbexa |
96 tests |
EUR 848.4 |
|
Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit |
abx390435-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit |
EM0166 |
FN Test |
96T |
EUR 628.92 |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml |
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate) |
RA0164-C.1 |
ScyTek Laboratories |
0.1 ml |
EUR 150 |
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate) |
RA0164-C.5 |
ScyTek Laboratories |
0.5 ml |
EUR 360 |
Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate) |
RA0165-C.1 |
ScyTek Laboratories |
0.1 ml |
EUR 150 |
Mouse Insulin C- peptide