Mouse Insulin C- peptide 

To Order Contact us:

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-96Tests 96 Tests
EUR 774

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-48T 48T
EUR 450
  • Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-96T 96T
EUR 582
  • Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-48Tests 48 Tests
EUR 446

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-96Tests 96 Tests
EUR 615

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-48Tests 48 Tests
EUR 465

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-96Tests 96 Tests
EUR 643

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-48T 48T
EUR 398
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-96T 96T
EUR 511
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-48T 48T
EUR 467
  • Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-96T 96T
EUR 605
  • Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-48Tests 48 Tests
EUR 387

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-96Tests 96 Tests
EUR 532

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-48Tests 48 Tests
EUR 465

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-96Tests 96 Tests
EUR 643

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-48Tests 48 Tests
EUR 404

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-96Tests 96 Tests
EUR 556

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-48Tests 48 Tests
EUR 486

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-96Tests 96 Tests
EUR 672

Mouse Insulin C-peptide (57-87 aa) [EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ ]

INSC35-P 500 ug
EUR 347

Insulin Blocking Peptide

AF5109-BP 1mg
EUR 195

Insulin Blocking Peptide

  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

Insulin Blocking Peptide

  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

Insulin Peptide (OVA)

  • EUR 523.00
  • EUR 244.00
  • EUR 1497.00
  • EUR 606.00
  • EUR 384.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Insulin; Clone 2D11-H5 (Concentrate)

A00114-C 1 ml
EUR 437

Insulin Receptor Blocking Peptide

AF4692-BP 1mg
EUR 195

Human Insulin B Peptide

abx670051-5mg 5 mg
EUR 356
  • Shipped within 1 week.

Insulin Receptor (INSR) Peptide

  • EUR 495.00
  • EUR 815.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Control/Blocking peptide Mouse BCL-2

BCL21-C 100 ug
EUR 164

Control/Blocking peptide for Mouse Vimentin (Vim)

VIM11-C 100 ug
EUR 164

Recombinant Mouse Insulin Like Growth Factor Binding Protein-5 (IGFBP-5) protein

IGFBP53-C 100 ul
EUR 286

ELISA kit for Human Insulin-like peptide INSL5,Insulin-like peptide 5

EK2663 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Insulin-like peptide INSL5,Insulin-like peptide 5 in samples from serum, plasma, tissue homogenates and other biological fluids.

Insulin Receptor (INSR) Blocking Peptide

  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

Insulin Receptor (INSR) Blocking Peptide

  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

Insulin Receptor (INSR) Amide Peptide

  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Insulin Receptor beta Blocking Peptide

DF6088-BP 1mg
EUR 195

Mouse Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx574867-96tests 96 tests
EUR 668
  • Shipped within 1-3 weeks.

Mouse Insulin- like peptide INSL6, Insl6 ELISA KIT

ELI-13429m 96 Tests
EUR 865

Mouse Insulin- like peptide INSL5, Insl5 ELISA KIT

ELI-43454m 96 Tests
EUR 865

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749MO-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Insulin-like peptide INSL5(INSL5) ELISA kit

  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Insulin-like peptide INSL5(INSL5) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Control/Blocking peptide for Mouse TATA box-binding protein

TATAB11-C 100 ug
EUR 164

Monoclonal Anti-Human Insulin C-peptide IgG, aff pure

INSC23-M 100 ul
EUR 482

Recombinant Mouse Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control

IGFBP33-C 100 ul
EUR 286

Control/Blocking peptide CD40

CD4011-C 100 ug
EUR 164

Control/Blocking peptide EOMES

EMS11-C 100 ug
EUR 164

Control/Blocking peptide for Mouse Neuronal migration protein doublecortin (DCX)

DCX11-C 100 ug
EUR 164

Control/Blocking peptide for Mouse Neurogenic differentation factor 1 (NeuroD1)

NEUD1-C 100 ug
EUR 164

Mouse C-Peptide/ C-Peptide ELISA Kit

E0316Mo 1 Kit
EUR 571

Mouse C-Peptide(C-Peptide) ELISA Kit

EM0947 96T
EUR 476.25
  • Detection range: 0.156-10 ng/ml
  • Alias: C-P(C-Peptide)/Connecting Peptide
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 0.094 ng/ml

Phospho-Insulin Receptor (Tyr1355) Blocking Peptide

AF4392-BP 1mg
EUR 195

Insulin Receptor (1142-1153) (Biotin) Peptide

  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Canine Insulin (INS) ELISA Kit

DLR-INS-c-48T 48T
EUR 624
  • Should the Canine Insulin (INS) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit

DLR-INS-c-96T 96T
EUR 821
  • Should the Canine Insulin (INS) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine Insulin (INS) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine Insulin (INS) ELISA Kit

RDR-INS-c-48Tests 48 Tests
EUR 672

Canine Insulin (INS) ELISA Kit

RDR-INS-c-96Tests 96 Tests
EUR 938

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-1 (IGFBP-1) protein control for WB

IGFBP13-C 100 ul
EUR 286

Recombinant (NSO) purified Mouse Insulin Like Growth Factor Binding Protein-2 (IGFBP-2) protein control for WB

IGFBP23-C 100 ul
EUR 286

Recombinant (NSO) purified Mouse/Insulin Like Growth Factor Binding Protein-6 (IGFBP-6) protein control for WB

IGFBP63-C 100 ul
EUR 286

Recombinant (Sf21) purified Mouse Insulin Like Growth Factor Binding Protein-7 (IGFBP-7) protein control for WB

IGFBP73-C 100 ul
EUR 286

Control/Blocking peptide Human BCL-2

BCL11-C 100 ug
EUR 164

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

  • EUR 704.00
  • EUR 286.00
  • EUR 2179.00
  • EUR 843.00
  • EUR 509.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-12 working days.

Human Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) Peptide

  • EUR 732.00
  • EUR 286.00
  • EUR 2305.00
  • EUR 885.00
  • EUR 523.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-12 working days.

IGF-I Receptor/Insulin Receptor Blocking Peptide

AF4697-BP 1mg
EUR 195

Insulin Receptor (INSR) (Phospho-Y1355) Blocking Peptide

  • EUR 314.00
  • EUR 509.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

Insulin Receptor (INSR) (Phospho-Y1361) Blocking Peptide

  • EUR 314.00
  • EUR 509.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

Kinase Domain of Insulin Receptor (1) Peptide

  • EUR 509.00
  • EUR 857.00
  • EUR 370.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Insulin Like Growth Factor 1 (IGF1) Peptide

  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Kinase Domain of Insulin Receptor (2) Peptide

  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Insulin Receptor (1142-1153), amide (Biotin) Peptide

  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 ELISA kit

E03R0119-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A sandwich ELISA for quantitative measurement of Mouse Relaxin/Insulin Like Family Peptide Receptor 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

RXFP1 ELISA Kit| Mouse Relaxin/Insulin Like Family Peptide Recep

EF012910 96 Tests
EUR 689

Mouse/rat Insulin B chain peptide (25-54 aa) [FVKQHLCGSHLVEALYLVCGERGFFYTPMS]

INSB25-P 500 ug
EUR 347

Insulin C-terminal Antibody

abx021216-1mg 1 mg
EUR 787
  • Shipped within 5-10 working days.

Rabbit anti-Lamin B1 Control/Blocking Peptide

BL11-C 100 ug
EUR 164

Beta catenin 1 (CTNNB1) Control/Blocking Peptide

BCTN11-C 100 ug
EUR 164

Control/Blocking peptide for Ephrin-B2 antibody

NIVE2B-C 100 ug
EUR 164

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-10ug 10ug
EUR 202
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-1mg 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-500ug 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

C988-50ug 50ug
EUR 496
Description: Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.

Custom Peptide Synthesis (crude and desalted; mg-kg size, price based upon peptide size: 2-100 aa)

PEP-C 1 Ask for price

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx576327-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.

Mouse C-Type Natriuretic Peptide (NPPC) Peptide

  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Mouse C-Type Natriuretic Peptide (NPPC) Peptide

  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Mouse Connecting Peptide (C-Peptide) ELISA Kit

  • EUR 6642.00
  • EUR 3542.00
  • EUR 825.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx051521-96tests 96 tests
EUR 754
  • Shipped within 5-10 working days.

Mouse Connecting Peptide (C-Peptide) ELISA Kit

abx255287-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.

Mouse C- Peptide, connecting peptide ELISA Kit

CELI-66099m 96 Tests
EUR 865

C-Peptide ELISA Kit| Mouse C-Peptide ELISA Kit

EF013534 96 Tests
EUR 689

Control/Blocking peptide for Mouse Microtubule-associated proteins 1A/1B light chain 3B (anti-Map1lc3b)

MAP13B-C 100 ug
EUR 164

Recombinant Human Insulin Like Growth Factor Binding Protein-3 (IGFBP-3) protein WB +ve control

IGFBP31-C 100 ul
EUR 286

Control/Blocking peptide Glutamate receptor ionotropic (NMDA/GRN1)

NMDA11-C 100 ug
EUR 164

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)

RA0164-C.1 0.1 ml
EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/794 (Concentrate)

RA0164-C.5 0.5 ml
EUR 300

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)

RA0165-C.1 0.1 ml
EUR 125

Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate)

RA0165-C.5 0.5 ml
EUR 300

Purified human recomb insulin-like growth factor binding protein 5 (IGFBP-5) protein WB +ve control

IGFBP51-C 100 ul
EUR 286

Mouse RXFP1(Relaxin/Insulin Like Family Peptide Receptor 1) ELISA Kit

EM0166 96T
EUR 524.1
  • Detection range: 15.625-1000 pg/ml
  • Uniprot ID: Q6R6I7
  • Alias: RXFP1/Relaxin/Insulin Like Family Peptide Receptor 1)
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 9.375pg/ml

Mouse Relaxin/Insulin Like Family Peptide Receptor 1 (RXFP1) ELISA Kit

abx254542-96tests 96 tests
EUR 707
  • Shipped within 5-12 working days.

Mouse Relaxin/Insulin Like Family Peptide Receptor 2 (RXFP2) ELISA Kit

abx390435-96tests 96 tests
EUR 911
  • Shipped within 5-12 working days.

Human Insulin-like peptide INSL5 (INSL5) ELISA Kit

abx570706-96tests 96 tests
EUR 668
  • Shipped within 1-3 weeks.

Human Insulin- like peptide INSL6, INSL6 ELISA KIT

ELI-12379h 96 Tests
EUR 824

Human Insulin- like peptide INSL5, INSL5 ELISA KIT

ELI-20454h 96 Tests
EUR 824

Bovine Insulin- like peptide INSL6, INSL6 ELISA KIT

ELI-42113b 96 Tests
EUR 928

Insulin Like Growth Factor 1 (IGF1) Blocking Peptide

  • EUR 272.00
  • EUR 411.00
  • 1 mg
  • 5 mg
  • Shipped within 5-10 working days.

Insulin Like Growth Factor 1 (IGF1) Analog Peptide

  • EUR 495.00
  • EUR 815.00
  • EUR 356.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Kinase Domain of Insulin Receptor (2) (Biotin) Peptide

  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Human Insulin-like peptide INSL5(INSL5) ELISA kit

CSB-EL011749HU-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Insulin-like peptide INSL5 (INSL5) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Insulin C- peptide