Accugel 19:1 40%
To Order Contact us: stephen@expresspharmapulse.com
FUNNEL, 40 MM, PP |
6120P-40 |
CORNING |
24/pk |
EUR 44 |
Description: Reusable Plastics; Reusable Funnels |
Acrylamide : bis 40%, 19:1 Solution |
A0420-050 |
GenDepot |
495ml |
EUR 151 |
Nogo-66 (1-40) |
B5247-1 |
ApexBio |
1 mg |
EUR 609 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Hu-48T |
DL Develop |
48T |
EUR 479 |
- Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Hu-96T |
DL Develop |
96T |
EUR 621 |
- Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Mu-48T |
DL Develop |
48T |
EUR 489 |
- Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Mu-96T |
DL Develop |
96T |
EUR 635 |
- Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Ra-48T |
DL Develop |
48T |
EUR 508 |
- Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Ra-96T |
DL Develop |
96T |
EUR 661 |
- Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 478 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 662 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 489 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 677 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 511 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 709 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 500 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 692 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 511 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 709 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 534 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 742 |
Acryl/Bis solution (19: 1), 40% (w/v) |
A0006 |
Bio Basic |
500ml |
EUR 77.84 |
- Product category: Electrophoresis Related/Acry/Bis-Acrylamide/Acryl/Bis
|
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
CORNING® REUSABLE PHENOLIC GPI 40-400 THREADED SCREW CAP WITH RUBBER LINER |
9999-40 |
CORNING |
72/pk |
EUR 140 |
Description: General Apparatus; Stoppers |
ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions) |
K1230-40 |
Biovision |
|
EUR 1061 |
ExoDNAUC? Circulating and Exosome-associated DNA Extraction Kit (Urine/Cell Media, 40 reactions) |
K1231-40 |
Biovision |
|
EUR 1061 |
FGF-19 Fibroblast Growth Factor-19 Human Recombinant Protein |
PROTO95750-1 |
BosterBio |
Regular: 25ug |
EUR 317 |
Description: FGF19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.;The FGF-19 is purified by proprietary chromatographic techniques. |
40 bp random library with flanking sequence; DNA aptamer |
DAL-N-40 |
Alpha Diagnostics |
100 ug |
EUR 408 |
DiagNano Gold Nanoparticle Medium Covalent Conjugation Kit, 40 nm |
GCK-M-40 |
Creative Diagnostics |
1 kit |
EUR 757 |
DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm, Cellular Uptake |
GFL-40-CU |
Creative Diagnostics |
1mL |
EUR 1365 |
Anti-Claudin-19 Antibody |
A08096-1 |
BosterBio |
100ul |
EUR 397 |
Description: Rabbit Polyclonal Antibody for Claudin-19 Antibody (CLDN19) detection. Tested with WB in Human, Rat. |
Anti-TCF-19 Antibody |
A10508-1 |
BosterBio |
100ul |
EUR 397 |
Description: Rabbit Polyclonal Antibody for TCF-19 Antibody (TCF19) detection. Tested with WB in Human, Mouse, Rat. |
Anti-MMP-19 Antibody |
A05171-1 |
BosterBio |
100ul |
EUR 397 |
Description: Rabbit Polyclonal Antibody for MMP-19 Antibody (MMP19) detection.tested for WB in Human, Mouse. |
Polyclonal KRT19 / CK19 / Cytokeratin 19 Antibody (aa21-40) |
APR17075G |
Leading Biology |
0.05mg |
EUR 484 |
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human KRT19 / CK19 / Cytokeratin 19 (aa21-40). This antibody is tested and proven to work in the following applications: |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 550 nm |
BR-40-550 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 600 nm |
BR-40-600 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 650 nm |
BR-40-650 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 750 nm |
BR-40-750 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 780 nm |
BR-40-780 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 808 nm |
BR-40-808 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 850 nm |
BR-40-850 |
Creative Diagnostics |
25 mL |
EUR 720 |
TESTO (Testosterone) ELISA test |
19 |
Biobase |
96T/Box |
Ask for price |
- Area of application: Hormone testing
|
Description: ELISA based test for quantitative detection of O (osterone) |
Anti-Cytokeratin 19 |
DB-103-1 |
DB Biotech |
1 ml |
EUR 450 |
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 550 nm |
OR-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 600 nm |
OR-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 650 nm |
OR-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 700 nm |
OR-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 750 nm |
OR-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFA-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFA-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFA-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFA-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFB-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RFB-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFB-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFB-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFC-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RFC-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFC-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFC-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFC-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFM-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFM-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFM-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFM-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFN-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RFN-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFN-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFN-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFN-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
Abeta 40 (beta amyloid 1-40) |
RA25009 |
Neuromics |
100 ul |
EUR 383 |
FGF-19, human recombinant protein |
P1050-.1 |
ApexBio |
100 µg |
EUR 738 |
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis. |
FGF-19, human recombinant protein |
P1050-1 |
ApexBio |
1 mg |
EUR 4156 |
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis. |
Recombinant Human IL-19 Protein |
PROTQ9UHD0-1 |
BosterBio |
10ug |
EUR 317 |
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer. |
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RCG-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RCG-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RCG-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RCG-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RCG-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RCN-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RCN-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RCN-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RCN-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RCS-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RCS-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RCS-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RCS-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFL-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RFL-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFL-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFL-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFL-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RGS-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RGS-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RGS-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RGS-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
Human Cyclophilin-40 (PPID) AssayMax ELISA Kit |
EC2050-1 |
AssayPro |
96 Well Plate |
EUR 417 |
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RCA-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RCA-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RCA-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RCA-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RCA-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 550 nm |
RCK-40-550 |
Creative Diagnostics |
1 kit |
EUR 1043 |
DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 600 nm |
RCK-40-600 |
Creative Diagnostics |
1 kit |
EUR 1043 |
DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 650 nm |
RCK-40-650 |
Creative Diagnostics |
1 kit |
EUR 1043 |
DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 700 nm |
RCK-40-700 |
Creative Diagnostics |
1 kit |
EUR 1043 |
DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 750 nm |
RCK-40-750 |
Creative Diagnostics |
1 kit |
EUR 1043 |
[Ser25] Protein Kinase C (19-31) |
A1033-1 |
ApexBio |
1 mg |
EUR 102 |
Description: Protein Kinase C (19-31), (C67H118N26O17), a peptide with the sequence H-ARG-PHE-ALA-ARG-LYS-GLY-SER-LEU-ARG-GLN-LYS-ASN-VAL-OH, MW= 1559.82. |
Anti-Cytokeratin 19 Rabbit Monoclonal Antibody |
M02101-1 |
BosterBio |
100ug/vial |
EUR 397 |
Description: Rabbit Monoclonal Cytokeratin 19 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse. |
DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RHA-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RHA-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RHA-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RHA-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RHG-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RHG-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RHG-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RHG-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RHG-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RHM-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RHM-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RHM-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RHM-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RHM-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RRG-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RRG-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RRG-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RRG-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RRG-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RMG-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RMG-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RMG-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RMG-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RMG-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
egg white lysozyme (19-36) [Gallus gallus] |
A1065-1 |
ApexBio |
1 mg |
EUR 108 |
Description: Sequence: H2N-KVFGRCELAAAMKRHGLD-OHFormula of Egg white lysozyme (19-36) [Gallus gallus]:C86H144N28O23S2Hen egg white lysozyme has a molecular weight of about 14,600 and each molecule comprises 129 amino acid residues1. |
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx175368 |
Abbexa |
-
EUR 398.00
-
EUR 133.00
-
EUR 1094.00
-
EUR 537.00
-
EUR 314.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx175369 |
Abbexa |
-
EUR 411.00
-
EUR 133.00
-
EUR 1135.00
-
EUR 551.00
-
EUR 314.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx132222 |
Abbexa |
-
EUR 425.00
-
EUR 133.00
-
EUR 1177.00
-
EUR 578.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Synthetic Amyloid Beta Peptide 1-40 (Ab1-40) |
4-SPA864Hu02 |
Cloud-Clone |
-
EUR 350.88
-
EUR 197.00
-
EUR 1040.80
-
EUR 413.60
-
EUR 727.20
-
EUR 298.00
-
EUR 2452.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P05067#PRO_0000000093
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): 4329.9Da
- Isoelectric Point: 5.3
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli |
MP (Mycoplasma Pneumoniae Antibody IgG) ELISA test |
40 |
Biobase |
96T/Box |
Ask for price |
- Area of application: Respiratory tract testing
|
Description: ELISA based test for quantitative detection of MP (Mycoplasma Pneumoniae Antibody IgG) |
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide |
abx670346-1mg |
Abbexa |
1 mg |
EUR 523 |
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide |
20-abx652283 |
Abbexa |
-
EUR 314.00
-
EUR 203.00
-
EUR 773.00
-
EUR 342.00
-
EUR 258.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu11 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P05067#PRO_0000000093
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu21 |
Cloud-Clone |
-
EUR 431.52
-
EUR 218.00
-
EUR 1343.20
-
EUR 514.40
-
EUR 928.80
-
EUR 352.00
-
EUR 3208.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P05067#PRO_0000000093
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu23 |
Cloud-Clone |
-
EUR 341.02
-
EUR 194.00
-
EUR 1003.84
-
EUR 401.28
-
EUR 702.56
-
EUR 291.00
-
EUR 2359.60
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P05067#PRO_0000000093
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Hu31 |
Cloud-Clone |
-
EUR 246.05
-
EUR 169.00
-
EUR 647.68
-
EUR 282.56
-
EUR 465.12
-
EUR 227.00
-
EUR 1469.20
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P05067#PRO_0000000093
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Mu11 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Mu21 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Mu31 |
Cloud-Clone |
-
EUR 246.05
-
EUR 169.00
-
EUR 647.68
-
EUR 282.56
-
EUR 465.12
-
EUR 227.00
-
EUR 1469.20
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Ra11 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Ra21 |
Cloud-Clone |
-
EUR 221.86
-
EUR 162.00
-
EUR 556.96
-
EUR 252.32
-
EUR 404.64
-
EUR 211.00
-
EUR 1242.40
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
4-CPA864Ra31 |
Cloud-Clone |
-
EUR 246.05
-
EUR 169.00
-
EUR 647.68
-
EUR 282.56
-
EUR 465.12
-
EUR 227.00
-
EUR 1469.20
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Inquire
- Buffer composition: PBS, pH 7.4.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): Inquire
- Isoelectric Point: Inquire
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
Rat beta-40(Amyloid Beta 1-40) ELISA Kit |
STJ150091 |
St John's Laboratory |
1 kit |
EUR 412 |
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids |
Human amyloid beta peptide 1-40,A?1-40 ELISA Kit |
201-12-1231 |
SunredBio |
96 tests |
EUR 440 |
- This amyloid beta peptide 1-40 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
ELISA kit for Human A?1-40 (Amyloid Beta 1-40) |
E-EL-H0542 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 377 |
- Gentaur's A?1-40 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human A?1-40. Standards or samples are added to the micro ELISA plate wells and combined wit
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Human A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Mouse A?1-40 (Amyloid Beta 1-40) |
E-EL-M0067 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 377 |
- Gentaur's A?1-40 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Mouse A?1-40. Standards or samples are added to the micro ELISA plate wells and combined wit
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Mouse A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Monkey A?1-40 (Amyloid Beta 1-40) |
E-EL-MK0477 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 584 |
- Gentaur's A?1-40 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Monkey A?1-40. Standards or samples are added to the micro ELISA plate wells and combined wi
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Monkey A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Rat A?1-40 (Amyloid Beta 1-40) |
E-EL-R1401 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 377 |
- Gentaur's A?1-40 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Rat A?1-40. Standards or samples are added to the micro ELISA plate wells and combined with
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Rat A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant |
Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
CSB-E08299h-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08299h |
Cusabio |
-
EUR 900.00
-
EUR 5476.00
-
EUR 2900.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
CSB-E08300m-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08300m |
Cusabio |
-
EUR 946.00
-
EUR 5782.00
-
EUR 3060.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
CSB-E08302r-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit |
1-CSB-E08302r |
Cusabio |
-
EUR 967.00
-
EUR 5925.00
-
EUR 3134.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Mouse Insulin ELISA Kit, High Sensitivity, Quantitative, 96 tests |
0030-40-1 |
Alpha Diagnostics |
1 kit |
EUR 712 |
KRT19 Human, Cytokeratin 19 Human Recombinant Protein , His Tag |
PROTP08727-1 |
BosterBio |
Regular: 20ug |
EUR 317 |
Description: KRT19 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 423 amino acids (1-400) and having a molecular mass of 46.5kDa.;KRT19 is fused to a 23 amino acid His-Tag at N-terminus and purified by proprietary chromatographic techniques. |
Beta 2 Microglobulin (B2M) Partially Pure (40-90%) |
B2M17-N-1 |
Alpha Diagnostics |
1 mg |
EUR 286 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
abx053393-96tests |
Abbexa |
96 tests |
EUR 668 |
- Shipped within 5-12 working days.
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx053394 |
Abbexa |
-
EUR 6971.00
-
EUR 3714.00
-
EUR 864.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-10 working days.
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx053396 |
Abbexa |
-
EUR 7237.00
-
EUR 3855.00
-
EUR 895.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-10 working days.
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
20-abx150496 |
Abbexa |
-
EUR 6642.00
-
EUR 3542.00
-
EUR 825.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
20-abx165634 |
Abbexa |
-
EUR 606.00
-
EUR 258.00
-
EUR 1817.00
-
EUR 718.00
-
EUR 439.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Accugel 19:1 40%