Accugel 19:1 40%
To Order Contact us: stephen@expresspharmapulse.com
Acrylamide : bis 40%, 19:1 Solution |
A0420-050 |
GenDepot |
495ml |
EUR 151 |
Nogo-66 (1-40) |
B5247-1 |
ApexBio |
1 mg |
EUR 609 |
FUNNEL, 40 MM, PP |
6120P-40 |
CORNING |
24/pk |
EUR 44 |
Description: Reusable Plastics; Reusable Funnels |
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Acryl/Bis solution (19: 1), 40% (w/v) |
A0006 |
Bio Basic |
500ml |
EUR 77.84 |
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 478 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 662 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 489 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 677 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 511 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RD-Ab1-40-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 709 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 500 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 692 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 511 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 709 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 534 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
RDR-Ab1-40-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 742 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Hu-48T |
DL Develop |
48T |
EUR 479 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Hu-96T |
DL Develop |
96T |
EUR 621 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Mu-48T |
DL Develop |
48T |
EUR 489 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Mu-96T |
DL Develop |
96T |
EUR 635 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Ra-48T |
DL Develop |
48T |
EUR 508 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
DLR-Ab1-40-Ra-96T |
DL Develop |
96T |
EUR 661 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
FGF-19 Recombinant Protein (Animal Free) |
40-719 |
ProSci |
5 ug |
EUR 269.75 |
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high-affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during brain development and embryogenesis. Recombinant Human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues. |
FGF-19 Recombinant Protein |
40-178-0005mg |
ProSci |
0.005 mg |
EUR 259.25 |
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues. |
FGF-19 Recombinant Protein |
40-178-0025mg |
ProSci |
0.025 mg |
EUR 364.25 |
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues. |
IL-19 Recombinant Protein |
40-264-0002mg |
ProSci |
0.002 mg |
EUR 259.25 |
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer. |
IL-19 Recombinant Protein |
40-264-001mg |
ProSci |
0.01 mg |
EUR 364.25 |
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer. |
TESTO (Testosterone) ELISA test |
19 |
Biobase |
96T/Box |
Ask for price |
|
Description: ELISA based test for quantitative detection of O (osterone) |
FGF-19 Fibroblast Growth Factor-19 Human Recombinant Protein |
PROTO95750-1 |
BosterBio |
Regular: 25ug |
EUR 317 |
Description: FGF19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.;The FGF-19 is purified by proprietary chromatographic techniques. |
Polyclonal KRT19 / CK19 / Cytokeratin 19 Antibody (aa21-40) |
APR17075G |
Leading Biology |
0.05mg |
EUR 484 |
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human KRT19 / CK19 / Cytokeratin 19 (aa21-40). This antibody is tested and proven to work in the following applications: |
Anti-MMP-19 Antibody |
A05171-1 |
BosterBio |
100ul |
EUR 397 |
Description: Rabbit Polyclonal Antibody for MMP-19 Antibody (MMP19) detection.tested for WB in Human, Mouse. |
Anti-Claudin-19 Antibody |
A08096-1 |
BosterBio |
100ul |
EUR 397 |
Description: Rabbit Polyclonal Antibody for Claudin-19 Antibody (CLDN19) detection. Tested with WB in Human, Rat. |
Anti-TCF-19 Antibody |
A10508-1 |
BosterBio |
100ul |
EUR 397 |
Description: Rabbit Polyclonal Antibody for TCF-19 Antibody (TCF19) detection. Tested with WB in Human, Mouse, Rat. |
Abeta 40 (beta amyloid 1-40) |
RA25009 |
Neuromics |
100 ul |
EUR 383 |
Anti-Cytokeratin 19 |
DB-103-1 |
DB Biotech |
1 ml |
EUR 450 |
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated |
Recombinant Human IL-19 Protein |
PROTQ9UHD0-1 |
BosterBio |
10ug |
EUR 317 |
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer. |
FGF-19, human recombinant protein |
P1050-.1 |
ApexBio |
100 µg |
EUR 738 |
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis. |
FGF-19, human recombinant protein |
P1050-1 |
ApexBio |
1 mg |
EUR 4156 |
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis. |
CORNING® REUSABLE PHENOLIC GPI 40-400 THREADED SCREW CAP WITH RUBBER LINER |
9999-40 |
CORNING |
72/pk |
EUR 140 |
Description: General Apparatus; Stoppers |
ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions) |
K1230-40 |
Biovision |
|
EUR 1061 |
ExoDNAUC? Circulating and Exosome-associated DNA Extraction Kit (Urine/Cell Media, 40 reactions) |
K1231-40 |
Biovision |
|
EUR 1061 |
Human Cyclophilin-40 (PPID) AssayMax ELISA Kit |
EC2050-1 |
AssayPro |
96 Well Plate |
EUR 417 |
DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm, Cellular Uptake |
GFL-40-CU |
Creative Diagnostics |
1mL |
EUR 1365 |
DiagNano Gold Nanoparticle Medium Covalent Conjugation Kit, 40 nm |
GCK-M-40 |
Creative Diagnostics |
1 kit |
EUR 757 |
40 bp random library with flanking sequence; DNA aptamer |
DAL-N-40 |
Alpha Diagnostics |
100 ug |
EUR 408 |
Anti-Cytokeratin 19 Rabbit Monoclonal Antibody |
M02101-1 |
BosterBio |
100ug/vial |
EUR 397 |
Description: Rabbit Monoclonal Cytokeratin 19 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse. |
[Ser25] Protein Kinase C (19-31) |
A1033-1 |
ApexBio |
1 mg |
EUR 102 |
Description: Protein Kinase C (19-31), (C67H118N26O17), a peptide with the sequence H-ARG-PHE-ALA-ARG-LYS-GLY-SER-LEU-ARG-GLN-LYS-ASN-VAL-OH, MW= 1559.82. |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 550 nm |
BR-40-550 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 600 nm |
BR-40-600 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 650 nm |
BR-40-650 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 750 nm |
BR-40-750 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 780 nm |
BR-40-780 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 808 nm |
BR-40-808 |
Creative Diagnostics |
25 mL |
EUR 720 |
DiagNano Gold Nanorods, diameter 40 nm, absorption max 850 nm |
BR-40-850 |
Creative Diagnostics |
25 mL |
EUR 720 |
Synthetic Amyloid Beta Peptide 1-40 (Ab1-40) |
4-SPA864Hu02 |
Cloud-Clone |
-
EUR 350.88
-
EUR 197.00
-
EUR 1040.80
-
EUR 413.60
-
EUR 727.20
-
EUR 298.00
-
EUR 2452.00
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli |
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx132222 |
Abbexa |
-
EUR 425.00
-
EUR 133.00
-
EUR 1177.00
-
EUR 578.00
-
EUR 328.00
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx175368 |
Abbexa |
-
EUR 398.00
-
EUR 133.00
-
EUR 1094.00
-
EUR 537.00
-
EUR 314.00
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
20-abx175369 |
Abbexa |
-
EUR 411.00
-
EUR 133.00
-
EUR 1135.00
-
EUR 551.00
-
EUR 314.00
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 550 nm |
OR-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 600 nm |
OR-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 650 nm |
OR-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 700 nm |
OR-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 750 nm |
OR-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFA-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFA-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFA-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFA-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFB-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RFB-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFB-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFB-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFC-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RFC-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFC-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFC-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFC-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFM-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFM-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFM-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFM-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 550 nm |
RFN-40-550 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 600 nm |
RFN-40-600 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 650 nm |
RFN-40-650 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 700 nm |
RFN-40-700 |
Creative Diagnostics |
1 mL |
EUR 1022 |
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 750 nm |
RFN-40-750 |
Creative Diagnostics |
1 mL |
EUR 1022 |
egg white lysozyme (19-36) [Gallus gallus] |
A1065-1 |
ApexBio |
1 mg |
EUR 108 |
Description: Sequence: H2N-KVFGRCELAAAMKRHGLD-OHFormula of Egg white lysozyme (19-36) [Gallus gallus]:C86H144N28O23S2Hen egg white lysozyme has a molecular weight of about 14,600 and each molecule comprises 129 amino acid residues1. |
Accugel 19:1 40%