Accugel 19:1 40% 

To Order Contact us:

450ML AccuGel 29:1 (40%)

NAT1188 450ML
EUR 109

1L AccuGel 29:1 (40%)

NAT1190 1L
EUR 140

450ML AccuGel 19:1 (30%)

NAT1176 450ML
EUR 105

1L AccuGel 19:1 (30%)

NAT1178 1L
EUR 138

450ML AccuGel 29:1 (30%)

NAT1184 450ML
EUR 105

1L AccuGel 29:1 (30%)

NAT1186 1L
EUR 138

Acrylamide : bis 40%, 19:1 Solution

A0420-050 495ml
EUR 151

Nogo-66 (1-40)

B5247-1 1 mg
EUR 609


6120P-40 24/pk
EUR 44
Description: Reusable Plastics; Reusable Funnels

40 x ELISA Wash Buffer

GR103014-40 1 L
EUR 199

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Acryl/Bis solution (19: 1), 40% (w/v)

A0006 500ml
EUR 77.84

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-48Tests 48 Tests
EUR 478

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-96Tests 96 Tests
EUR 662

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-48Tests 48 Tests
EUR 489

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Mu-96Tests 96 Tests
EUR 677

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-48Tests 48 Tests
EUR 511

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-96Tests 96 Tests
EUR 709

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 500

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 692

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 511

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 709

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 534

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 742

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-48T 48T
EUR 479
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Hu-96T 96T
EUR 621
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-48T 48T
EUR 489
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Mu-96T 96T
EUR 635
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-48T 48T
EUR 508
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-96T 96T
EUR 661
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm

GFL-40 1 mL
EUR 1053

FGF-19 Recombinant Protein (Animal Free)

40-719 5 ug
EUR 269.75
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high-affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during brain development and embryogenesis. Recombinant Human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

DiagNano Gold Nanoparticle Passive Conjugation Kit, 40 nm

GPK-40 1 kit
EUR 715

Cytokeratin 19 (40 kD); Clone BA 17

A00094 6 ml
EUR 220

Cytokeratin 19 (40 kD); Clone BA 17

A00094.0025 25 ml
EUR 514

Cytokeratin 19 (40 kD); Clone BA 17

A20094 2 ml
EUR 136

FGF-19 Recombinant Protein

40-178-0005mg 0.005 mg
EUR 259.25
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

FGF-19 Recombinant Protein

40-178-0025mg 0.025 mg
EUR 364.25
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

IL-19 Recombinant Protein

40-264-0002mg 0.002 mg
EUR 259.25
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

IL-19 Recombinant Protein

40-264-001mg 0.01 mg
EUR 364.25
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

TESTO (Testosterone) ELISA test

19 96T/Box Ask for price
Description: ELISA based test for quantitative detection of O (osterone)

FGF-19 Fibroblast Growth Factor-19 Human Recombinant Protein

PROTO95750-1 Regular: 25ug
EUR 317
Description: FGF19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.;The FGF-19 is purified by proprietary chromatographic techniques.

Polyclonal KRT19 / CK19 / Cytokeratin 19 Antibody (aa21-40)

APR17075G 0.05mg
EUR 484
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human KRT19 / CK19 / Cytokeratin 19 (aa21-40). This antibody is tested and proven to work in the following applications:

Anti-MMP-19 Antibody

A05171-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for MMP-19 Antibody (MMP19) detection.tested for WB in Human, Mouse.

Anti-Claudin-19 Antibody

A08096-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Claudin-19 Antibody (CLDN19) detection. Tested with WB in Human, Rat.

Anti-TCF-19 Antibody

A10508-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCF-19 Antibody (TCF19) detection. Tested with WB in Human, Mouse, Rat.

Abeta 40 (beta amyloid 1-40)

RA25009 100 ul
EUR 383

Anti-Cytokeratin 19

DB-103-1 1 ml
EUR 450
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated


9999-40 72/pk
EUR 140
Description: General Apparatus; Stoppers

ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions)

EUR 1061

ExoDNAUC? Circulating and Exosome-associated DNA Extraction Kit (Urine/Cell Media, 40 reactions)

EUR 1061

Recombinant Human IL-19 Protein

PROTQ9UHD0-1 10ug
EUR 317
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

FGF-19, human recombinant protein

P1050-.1 100 µg
EUR 738
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.

FGF-19, human recombinant protein

P1050-1 1 mg
EUR 4156
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.

Human Cyclophilin-40 (PPID) AssayMax ELISA Kit

EC2050-1 96 Well Plate
EUR 417

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm, Cellular Uptake

GFL-40-CU 1mL
EUR 1365

DiagNano Gold Nanoparticle Medium Covalent Conjugation Kit, 40 nm

GCK-M-40 1 kit
EUR 757

40 bp random library with flanking sequence; DNA aptamer

DAL-N-40 100 ug
EUR 408

Anti-Cytokeratin 19 Rabbit Monoclonal Antibody

M02101-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Cytokeratin 19 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse.

[Ser25] Protein Kinase C (19-31)

A1033-1 1 mg
EUR 102
Description: Protein Kinase C (19-31), (C67H118N26O17), a peptide with the sequence H-ARG-PHE-ALA-ARG-LYS-GLY-SER-LEU-ARG-GLN-LYS-ASN-VAL-OH, MW= 1559.82.

DiagNano Gold Nanorods, diameter 40 nm, absorption max 550 nm

BR-40-550 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 600 nm

BR-40-600 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 650 nm

BR-40-650 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 750 nm

BR-40-750 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 780 nm

BR-40-780 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 808 nm

BR-40-808 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 850 nm

BR-40-850 25 mL
EUR 720

Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 350.88
  • EUR 197.00
  • EUR 1040.80
  • EUR 413.60
  • EUR 727.20
  • EUR 298.00
  • EUR 2452.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

  • EUR 425.00
  • EUR 133.00
  • EUR 1177.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

  • EUR 398.00
  • EUR 133.00
  • EUR 1094.00
  • EUR 537.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

  • EUR 411.00
  • EUR 133.00
  • EUR 1135.00
  • EUR 551.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 550 nm

OR-40-550 1 mL
EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 600 nm

OR-40-600 1 mL
EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 650 nm

OR-40-650 1 mL
EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 700 nm

OR-40-700 1 mL
EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 750 nm

OR-40-750 1 mL
EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFA-40-550 1 mL
EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFA-40-650 1 mL
EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 700 nm

RFA-40-700 1 mL
EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFA-40-750 1 mL
EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFB-40-550 1 mL
EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 600 nm

RFB-40-600 1 mL
EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFB-40-650 1 mL
EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFB-40-750 1 mL
EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFC-40-550 1 mL
EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 600 nm

RFC-40-600 1 mL
EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFC-40-650 1 mL
EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 700 nm

RFC-40-700 1 mL
EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFC-40-750 1 mL
EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFM-40-550 1 mL
EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFM-40-650 1 mL
EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 700 nm

RFM-40-700 1 mL
EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFM-40-750 1 mL
EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFN-40-550 1 mL
EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 600 nm

RFN-40-600 1 mL
EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFN-40-650 1 mL
EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 700 nm

RFN-40-700 1 mL
EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFN-40-750 1 mL
EUR 1022

egg white lysozyme (19-36) [Gallus gallus]

A1065-1 1 mg
EUR 108
Description: Sequence: H2N-KVFGRCELAAAMKRHGLD-OHFormula of Egg white lysozyme (19-36) [Gallus gallus]:C86H144N28O23S2Hen egg white lysozyme has a molecular weight of about 14,600 and each molecule comprises 129 amino acid residues1.

β-Amyloid (1-40)

HY-P0265 5mg
EUR 587


5-00456 4 x 1mg Ask for price

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RCG-40-550 1 mL
EUR 1022

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RCG-40-600 1 mL
EUR 1022

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RCG-40-650 1 mL
EUR 1022

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RCG-40-700 1 mL
EUR 1022

DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RCG-40-750 1 mL
EUR 1022

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RCN-40-550 1 mL
EUR 1022

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RCN-40-600 1 mL
EUR 1022

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RCN-40-650 1 mL
EUR 1022

DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RCN-40-700 1 mL
EUR 1022

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RCS-40-550 1 mL
EUR 1022

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RCS-40-600 1 mL
EUR 1022

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RCS-40-700 1 mL
EUR 1022

DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RCS-40-750 1 mL
EUR 1022

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 550 nm

RFL-40-550 1 mL
EUR 1022

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 600 nm

RFL-40-600 1 mL
EUR 1022

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 650 nm

RFL-40-650 1 mL
EUR 1022

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 700 nm

RFL-40-700 1 mL
EUR 1022

DiagNano Fluorophore Labeled Gold Nanorods, diameter 40 nm, absorption max 750 nm

RFL-40-750 1 mL
EUR 1022

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RGS-40-700 1 mL
EUR 1022

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RGS-40-550 1 mL
EUR 1022

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RGS-40-650 1 mL
EUR 1022

DiagNano GSH conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RGS-40-750 1 mL
EUR 1022

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 431.52
  • EUR 218.00
  • EUR 1343.20
  • EUR 514.40
  • EUR 928.80
  • EUR 352.00
  • EUR 3208.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 341.02
  • EUR 194.00
  • EUR 1003.84
  • EUR 401.28
  • EUR 702.56
  • EUR 291.00
  • EUR 2359.60
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 246.05
  • EUR 169.00
  • EUR 647.68
  • EUR 282.56
  • EUR 465.12
  • EUR 227.00
  • EUR 1469.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 246.05
  • EUR 169.00
  • EUR 647.68
  • EUR 282.56
  • EUR 465.12
  • EUR 227.00
  • EUR 1469.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 221.86
  • EUR 162.00
  • EUR 556.96
  • EUR 252.32
  • EUR 404.64
  • EUR 211.00
  • EUR 1242.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

  • EUR 246.05
  • EUR 169.00
  • EUR 647.68
  • EUR 282.56
  • EUR 465.12
  • EUR 227.00
  • EUR 1469.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

Rat beta-40(Amyloid Beta 1-40) ELISA Kit

STJ150091 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

  • EUR 314.00
  • EUR 203.00
  • EUR 773.00
  • EUR 342.00
  • EUR 258.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

abx670346-1mg 1 mg
EUR 523

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

CSB-E08299h-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

  • EUR 900.00
  • EUR 5476.00
  • EUR 2900.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

CSB-E08300m-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

  • EUR 946.00
  • EUR 5782.00
  • EUR 3060.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

CSB-E08302r-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

  • EUR 967.00
  • EUR 5925.00
  • EUR 3134.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

ELISA kit for Mouse A?1-40 (Amyloid Beta 1-40)

E-EL-M0067 1 plate of 96 wells
EUR 377
Description: A sandwich ELISA kit for quantitative measurement of Mouse A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Monkey A?1-40 (Amyloid Beta 1-40)

E-EL-MK0477 1 plate of 96 wells
EUR 584
Description: A sandwich ELISA kit for quantitative measurement of Monkey A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human A?1-40 (Amyloid Beta 1-40)

E-EL-H0542 1 plate of 96 wells
EUR 377
Description: A sandwich ELISA kit for quantitative measurement of Human A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Rat A?1-40 (Amyloid Beta 1-40)

E-EL-R1401 1 plate of 96 wells
EUR 377
Description: A sandwich ELISA kit for quantitative measurement of Rat A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

Human amyloid beta peptide 1-40,A?1-40 ELISA Kit

201-12-1231 96 tests
EUR 440
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RCA-40-550 1 mL
EUR 1022

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RCA-40-600 1 mL
EUR 1022

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RCA-40-650 1 mL
EUR 1022

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RCA-40-700 1 mL
EUR 1022

DiagNano Protein A conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RCA-40-750 1 mL
EUR 1022

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 550 nm

RCK-40-550 1 kit
EUR 1043

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 600 nm

RCK-40-600 1 kit
EUR 1043

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 650 nm

RCK-40-650 1 kit
EUR 1043

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 700 nm

RCK-40-700 1 kit
EUR 1043

DiagNano Gold Nanorods Covalent Conjugation Kit, diameter 40 nm, absorption max 750 nm

RCK-40-750 1 kit
EUR 1043

Beta 2 Microglobulin (B2M) Partially Pure (40-90%)

B2M17-N-1 1 mg
EUR 286

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RMG-40-550 1 mL
EUR 1022

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RMG-40-600 1 mL
EUR 1022

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RMG-40-650 1 mL
EUR 1022

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RMG-40-700 1 mL
EUR 1022

DiagNano Anti-Mouse IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RMG-40-750 1 mL
EUR 1022

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RRG-40-550 1 mL
EUR 1022

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RRG-40-600 1 mL
EUR 1022

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RRG-40-650 1 mL
EUR 1022

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RRG-40-700 1 mL
EUR 1022

DiagNano Anti-Rabbit IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RRG-40-750 1 mL
EUR 1022

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RHA-40-550 1 mL
EUR 1022

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RHA-40-600 1 mL
EUR 1022

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RHA-40-650 1 mL
EUR 1022

DiagNano Anti-Human IgA conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RHA-40-750 1 mL
EUR 1022

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RHG-40-550 1 mL
EUR 1022

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RHG-40-600 1 mL
EUR 1022

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RHG-40-650 1 mL
EUR 1022

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RHG-40-700 1 mL
EUR 1022

DiagNano Anti-Human IgG conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RHG-40-750 1 mL
EUR 1022

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm

RHM-40-550 1 mL
EUR 1022

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm

RHM-40-600 1 mL
EUR 1022

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm

RHM-40-650 1 mL
EUR 1022

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm

RHM-40-700 1 mL
EUR 1022

DiagNano Anti-Human IgM conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm

RHM-40-750 1 mL
EUR 1022

KRT19 Human, Cytokeratin 19 Human Recombinant Protein , His Tag

PROTP08727-1 Regular: 20ug
EUR 317
Description: KRT19 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 423 amino acids (1-400) and having a molecular mass of 46.5kDa.;KRT19 is fused to a 23 amino acid His-Tag at N-terminus and purified by proprietary chromatographic techniques.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat)

  • EUR 243.00
  • EUR 2457.00
  • EUR 613.00
  • EUR 305.00
  • EUR 212.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40)

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-10x96wellstestplate 10x96-wells test plate
EUR 4273.35
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Accugel 19:1 40%