Accugel 19:1 40% 

To Order Contact us: stephen@expresspharmapulse.com

1L AccuGel 19:1 (40%)
NAT1182 1L
EUR 140
450ML AccuGel 29:1 (40%)
NAT1188 450ML
EUR 109
1L AccuGel 29:1 (40%)
NAT1190 1L
EUR 140
450ML AccuGel 19:1 (30%)
NAT1176 450ML
EUR 105
1L AccuGel 19:1 (30%)
NAT1178 1L
EUR 138
FUNNEL, 40 MM, PP
6120P-40 24/pk
EUR 44
Description: Reusable Plastics; Reusable Funnels
Acrylamide : bis 40%, 19:1 Solution
A0420-050 495ml
EUR 151
450ML AccuGel 29:1 (30%)
NAT1184 450ML
EUR 105
1L AccuGel 29:1 (30%)
NAT1186 1L
EUR 138
Nogo-66 (1-40)
B5247-1 1 mg
EUR 609
DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm
GFL-40 1 mL
EUR 1053
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-48T 48T
EUR 479
  • Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-96T 96T
EUR 621
  • Should the Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-48T 48T
EUR 489
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-96T 96T
EUR 635
  • Should the Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-48T 48T
EUR 508
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-96T 96T
EUR 661
  • Should the Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-48Tests 48 Tests
EUR 478
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-96Tests 96 Tests
EUR 662
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-48Tests 48 Tests
EUR 489
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-96Tests 96 Tests
EUR 677
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-48Tests 48 Tests
EUR 511
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-96Tests 96 Tests
EUR 709
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 500
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 692
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 511
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 709
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 534
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 742
DiagNano Gold Nanoparticle Passive Conjugation Kit, 40 nm
GPK-40 1 kit
EUR 715
Acryl/Bis solution (19: 1), 40% (w/v)
A0006 500ml
EUR 77.84
  • Product category: Electrophoresis Related/Acry/Bis-Acrylamide/Acryl/Bis
Amyloid Beta-Peptide (1-40) (human)
A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
Cytokeratin 19 (40 kD); Clone BA 17
A00094 6 ml
EUR 220
Cytokeratin 19 (40 kD); Clone BA 17
A00094.0025 25 ml
EUR 514
Cytokeratin 19 (40 kD); Clone BA 17
A20094 2 ml
EUR 136
CORNING® REUSABLE PHENOLIC GPI 40-400 THREADED SCREW CAP WITH RUBBER LINER
9999-40 72/pk
EUR 140
Description: General Apparatus; Stoppers
ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions)
K1230-40
EUR 1061
ExoDNAUC? Circulating and Exosome-associated DNA Extraction Kit (Urine/Cell Media, 40 reactions)
K1231-40
EUR 1061
FGF-19 Fibroblast Growth Factor-19 Human Recombinant Protein
PROTO95750-1 Regular: 25ug
EUR 317
Description: FGF19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.;The FGF-19 is purified by proprietary chromatographic techniques.
40 bp random library with flanking sequence; DNA aptamer
DAL-N-40 100 ug
EUR 408
DiagNano Gold Nanoparticle Medium Covalent Conjugation Kit, 40 nm
GCK-M-40 1 kit
EUR 757
DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm, Cellular Uptake
GFL-40-CU 1mL
EUR 1365
Anti-Claudin-19 Antibody
A08096-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Claudin-19 Antibody (CLDN19) detection. Tested with WB in Human, Rat.
Anti-TCF-19 Antibody
A10508-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCF-19 Antibody (TCF19) detection. Tested with WB in Human, Mouse, Rat.
Anti-MMP-19 Antibody
A05171-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for MMP-19 Antibody (MMP19) detection.tested for WB in Human, Mouse.
Polyclonal KRT19 / CK19 / Cytokeratin 19 Antibody (aa21-40)
APR17075G 0.05mg
EUR 484
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human KRT19 / CK19 / Cytokeratin 19 (aa21-40). This antibody is tested and proven to work in the following applications:
DiagNano Gold Nanorods, diameter 40 nm, absorption max 550 nm
BR-40-550 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 600 nm
BR-40-600 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 650 nm
BR-40-650 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 750 nm
BR-40-750 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 780 nm
BR-40-780 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 808 nm
BR-40-808 25 mL
EUR 720
DiagNano Gold Nanorods, diameter 40 nm, absorption max 850 nm
BR-40-850 25 mL
EUR 720
TESTO (Testosterone) ELISA test
19 96T/Box Ask for price
  • Area of application: Hormone testing
Description: ELISA based test for quantitative detection of O (osterone)
Anti-Cytokeratin 19
DB-103-1 1 ml
EUR 450
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 550 nm
OR-40-550 1 mL
EUR 1022
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 600 nm
OR-40-600 1 mL
EUR 1022
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 650 nm
OR-40-650 1 mL
EUR 1022
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 700 nm
OR-40-700 1 mL
EUR 1022
DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 750 nm
OR-40-750 1 mL
EUR 1022
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFA-40-550 1 mL
EUR 1022
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFA-40-650 1 mL
EUR 1022
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFA-40-700 1 mL
EUR 1022
DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFA-40-750 1 mL
EUR 1022
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFB-40-550 1 mL
EUR 1022
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFB-40-600 1 mL
EUR 1022
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFB-40-650 1 mL
EUR 1022
DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFB-40-750 1 mL
EUR 1022
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFC-40-550 1 mL
EUR 1022
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFC-40-600 1 mL
EUR 1022
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFC-40-650 1 mL
EUR 1022
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFC-40-700 1 mL
EUR 1022
DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFC-40-750 1 mL
EUR 1022
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFM-40-550 1 mL
EUR 1022
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFM-40-650 1 mL
EUR 1022
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFM-40-700 1 mL
EUR 1022
DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFM-40-750 1 mL
EUR 1022
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFN-40-550 1 mL
EUR 1022
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFN-40-600 1 mL
EUR 1022
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFN-40-650 1 mL
EUR 1022
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFN-40-700 1 mL
EUR 1022
DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFN-40-750 1 mL
EUR 1022
Abeta 40 (beta amyloid 1-40)
RA25009 100 ul
EUR 383
FGF-19, human recombinant protein
P1050-.1 100 µg
EUR 738
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.
FGF-19, human recombinant protein
P1050-1 1 mg
EUR 4156
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.
Recombinant Human IL-19 Protein
PROTQ9UHD0-1 10ug
EUR 317
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCG-40-550 1 mL
EUR 1022
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCG-40-600 1 mL
EUR 1022
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RCG-40-650 1 mL
EUR 1022
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCG-40-700 1 mL
EUR 1022
DiagNano Galactose conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RCG-40-750 1 mL
EUR 1022
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCN-40-550 1 mL
EUR 1022
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCN-40-600 1 mL
EUR 1022
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 650 nm
RCN-40-650 1 mL
EUR 1022
DiagNano NeutrAvidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCN-40-700 1 mL
EUR 1022
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 550 nm
RCS-40-550 1 mL
EUR 1022
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 600 nm
RCS-40-600 1 mL
EUR 1022
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 700 nm
RCS-40-700 1 mL
EUR 1022
DiagNano Streptavidin conjugated Gold Nanorods, diameter 40 nm, absorption max 750 nm
RCS-40-750 1 mL
EUR 1022

Accugel 19:1 40%