Accugel 19:1 40% 

To Order Contact us: stephen@expresspharmapulse.com

450ML AccuGel 29:1 (40%)
NAT1188 450ML
EUR 109

1L AccuGel 29:1 (40%)
NAT1190 1L
EUR 140

450ML AccuGel 19:1 (30%)
NAT1176 450ML
EUR 105

1L AccuGel 19:1 (30%)
NAT1178 1L
EUR 138

450ML AccuGel 29:1 (30%)
NAT1184 450ML
EUR 105

1L AccuGel 29:1 (30%)
NAT1186 1L
EUR 138

Acrylamide : bis 40%, 19:1 Solution
A0420-050 495ml
EUR 151

Nogo-66 (1-40)
B5247-1 1 mg
EUR 609

FUNNEL, 40 MM, PP
6120P-40 24/pk
EUR 44
Description: Reusable Plastics; Reusable Funnels

Amyloid Beta-Peptide (1-40) (human)
A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Acryl/Bis solution (19: 1), 40% (w/v)
A0006 500ml
EUR 77.84

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-48Tests 48 Tests
EUR 478

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Hu-96Tests 96 Tests
EUR 662

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-48Tests 48 Tests
EUR 489

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Mu-96Tests 96 Tests
EUR 677

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-48Tests 48 Tests
EUR 511

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RD-Ab1-40-Ra-96Tests 96 Tests
EUR 709

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 500

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 692

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-48Tests 48 Tests
EUR 511

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Mu-96Tests 96 Tests
EUR 709

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 534

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 742

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-48T 48T
EUR 479
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-96T 96T
EUR 621
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-48T 48T
EUR 489
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-96T 96T
EUR 635
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-48T 48T
EUR 508
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-96T 96T
EUR 661
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm
GFL-40 1 mL
EUR 1053

FGF-19 Recombinant Protein (Animal Free)
40-719 5 ug
EUR 269.75
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high-affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during brain development and embryogenesis. Recombinant Human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

DiagNano Gold Nanoparticle Passive Conjugation Kit, 40 nm
GPK-40 1 kit
EUR 715

Cytokeratin 19 (40 kD); Clone BA 17
A00094 6 ml
EUR 220

Cytokeratin 19 (40 kD); Clone BA 17
A00094.0025 25 ml
EUR 514

Cytokeratin 19 (40 kD); Clone BA 17
A20094 2 ml
EUR 136

FGF-19 Recombinant Protein
40-178-0005mg 0.005 mg
EUR 259.25
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

FGF-19 Recombinant Protein
40-178-0025mg 0.025 mg
EUR 364.25
Description: The FGF family plays central roles during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-19, a member of the FGF family, is a high affinity heparin dependent ligand for FGFR4. FGF-19 is expressed during the brain development and embryogenesis. Recombinant human FGF-19 is a 21.8 kDa protein containing 195 amino acid residues.

IL-19 Recombinant Protein
40-264-0002mg 0.002 mg
EUR 259.25
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

IL-19 Recombinant Protein
40-264-001mg 0.01 mg
EUR 364.25
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

TESTO (Testosterone) ELISA test
19 96T/Box Ask for price
Description: ELISA based test for quantitative detection of O (osterone)

FGF-19 Fibroblast Growth Factor-19 Human Recombinant Protein
PROTO95750-1 Regular: 25ug
EUR 317
Description: FGF19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.;The FGF-19 is purified by proprietary chromatographic techniques.

Polyclonal KRT19 / CK19 / Cytokeratin 19 Antibody (aa21-40)
APR17075G 0.05mg
EUR 484
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human KRT19 / CK19 / Cytokeratin 19 (aa21-40). This antibody is tested and proven to work in the following applications:

Anti-MMP-19 Antibody
A05171-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for MMP-19 Antibody (MMP19) detection.tested for WB in Human, Mouse.

Anti-Claudin-19 Antibody
A08096-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Claudin-19 Antibody (CLDN19) detection. Tested with WB in Human, Rat.

Anti-TCF-19 Antibody
A10508-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCF-19 Antibody (TCF19) detection. Tested with WB in Human, Mouse, Rat.

Abeta 40 (beta amyloid 1-40)
RA25009 100 ul
EUR 383

Anti-Cytokeratin 19
DB-103-1 1 ml
EUR 450
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Recombinant Human IL-19 Protein
PROTQ9UHD0-1 10ug
EUR 317
Description: IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.

FGF-19, human recombinant protein
P1050-.1 100 µg
EUR 738
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.

FGF-19, human recombinant protein
P1050-1 1 mg
EUR 4156
Description: Fibroblast Growth Factor-19 (FGF-19) is a member of the FGF family and is a high-affinity heparin-dependent ligand for FGFR4 expressed during brain development and embryogenesis.

CORNING® REUSABLE PHENOLIC GPI 40-400 THREADED SCREW CAP WITH RUBBER LINER
9999-40 72/pk
EUR 140
Description: General Apparatus; Stoppers

ExoDNAPS? Circulating and Exosome-associated DNA Extraction Kit (Human Plasma/Serum, 40 reactions)
K1230-40
EUR 1061

ExoDNAUC? Circulating and Exosome-associated DNA Extraction Kit (Urine/Cell Media, 40 reactions)
K1231-40
EUR 1061

Human Cyclophilin-40 (PPID) AssayMax ELISA Kit
EC2050-1 96 Well Plate
EUR 417

DiagNano Fluorophore Labeled Gold Nanoparticles, 40 nm, Cellular Uptake
GFL-40-CU 1mL
EUR 1365

DiagNano Gold Nanoparticle Medium Covalent Conjugation Kit, 40 nm
GCK-M-40 1 kit
EUR 757

40 bp random library with flanking sequence; DNA aptamer
DAL-N-40 100 ug
EUR 408

Anti-Cytokeratin 19 Rabbit Monoclonal Antibody
M02101-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Cytokeratin 19 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse.

[Ser25] Protein Kinase C (19-31)
A1033-1 1 mg
EUR 102
Description: Protein Kinase C (19-31), (C67H118N26O17), a peptide with the sequence H-ARG-PHE-ALA-ARG-LYS-GLY-SER-LEU-ARG-GLN-LYS-ASN-VAL-OH, MW= 1559.82.

DiagNano Gold Nanorods, diameter 40 nm, absorption max 550 nm
BR-40-550 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 600 nm
BR-40-600 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 650 nm
BR-40-650 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 750 nm
BR-40-750 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 780 nm
BR-40-780 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 808 nm
BR-40-808 25 mL
EUR 720

DiagNano Gold Nanorods, diameter 40 nm, absorption max 850 nm
BR-40-850 25 mL
EUR 720

Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)
4-SPA864Hu02
  • EUR 350.88
  • EUR 197.00
  • EUR 1040.80
  • EUR 413.60
  • EUR 727.20
  • EUR 298.00
  • EUR 2452.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx132222
  • EUR 425.00
  • EUR 133.00
  • EUR 1177.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx175368
  • EUR 398.00
  • EUR 133.00
  • EUR 1094.00
  • EUR 537.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody
20-abx175369
  • EUR 411.00
  • EUR 133.00
  • EUR 1135.00
  • EUR 551.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 550 nm
OR-40-550 1 mL
EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 600 nm
OR-40-600 1 mL
EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 650 nm
OR-40-650 1 mL
EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 700 nm
OR-40-700 1 mL
EUR 1022

DiagNano Organic Gold Nanorods, diameter 40 nm, absorption max 750 nm
OR-40-750 1 mL
EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFA-40-550 1 mL
EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFA-40-650 1 mL
EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFA-40-700 1 mL
EUR 1022

DiagNano Amine Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFA-40-750 1 mL
EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFB-40-550 1 mL
EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFB-40-600 1 mL
EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFB-40-650 1 mL
EUR 1022

DiagNano Biotin Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFB-40-750 1 mL
EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFC-40-550 1 mL
EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFC-40-600 1 mL
EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFC-40-650 1 mL
EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFC-40-700 1 mL
EUR 1022

DiagNano Carboxyl Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFC-40-750 1 mL
EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFM-40-550 1 mL
EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFM-40-650 1 mL
EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFM-40-700 1 mL
EUR 1022

DiagNano Methyl Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFM-40-750 1 mL
EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 550 nm
RFN-40-550 1 mL
EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 600 nm
RFN-40-600 1 mL
EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 650 nm
RFN-40-650 1 mL
EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 700 nm
RFN-40-700 1 mL
EUR 1022

DiagNano NHS Gold Nanorods, diameter 40 nm, absorption max 750 nm
RFN-40-750 1 mL
EUR 1022

egg white lysozyme (19-36) [Gallus gallus]
A1065-1 1 mg
EUR 108
Description: Sequence: H2N-KVFGRCELAAAMKRHGLD-OHFormula of Egg white lysozyme (19-36) [Gallus gallus]:C86H144N28O23S2Hen egg white lysozyme has a molecular weight of about 14,600 and each molecule comprises 129 amino acid residues1.

Accugel 19:1 40%